KEGG   Geoglobus acetivorans: GACE_0158Help
Entry
GACE_0158         CDS       T03507                                 

Definition
(GenBank) ribulose bisophosphate carboxylase (large subunit)
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
gac  Geoglobus acetivorans
Pathway
gac00630  Glyoxylate and dicarboxylate metabolism
gac01100  Metabolic pathways
gac01120  Microbial metabolism in diverse environments
gac01200  Carbon metabolism
Module
gac_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:gac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GACE_0158
Enzymes [BR:gac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     GACE_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AIY89215
UniProt: A0A0A7GB04
LinkDB All DBs
Position
complement(131095..132429)
Genome map
AA seq 444 aa AA seqDB search
MTERFDKIYDYYVDKDYEPNYKRDVVAVFRITPAEGYTIEQAAGGVAAESSTGTWTTLYP
WYEMERWEDLSAKAYDFHDMGDGSWMVKIAYPSHAFEENNLPALLASIAGNVFGMRRVNG
LRLEDLYFPEKIIREFNGPAFGIEGVRKMLDIKERPIYGVVPKPKVGYSPEELYSLAEEL
LLSGADFVKDDENLASPWYNRFEERAEVMANIIEKVENETGEKKTWFANITGDVRDMEYR
LELLSELSLKHAMVDVVISGWAVLEYIRDLAEDYDIAIHGHRAMHAAMTRNPRHGISMFV
LAKLYRLVGIDQLHVGTAGAGKLEGKKWDVLQNTKVLRENRYVPEDGDVFHLEQKFYGIK
PAFPTSSGGLHPGILPKVIEALGTDIVLQLGGGTIGHPDGPGSGARAVRQALEAIVQNIP
LEEYAKSHSELARALEKWGTETPI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaggtttgacaagatatatgattactacgtggataaggattacgaaccgaat
tacaagagggatgtggtcgcagttttcaggattacgcctgctgaaggctatacaatcgag
caggctgccggcggtgtggctgcagaaagctcgacgggtacctggacgaccctttacccg
tggtatgagatggagagatgggaggacctgtctgcaaaggcatacgatttccacgacatg
ggcgatggaagctggatggtgaaaatagcctatccgtctcatgcttttgaggaaaacaac
ctgccagccctccttgcatcaatagcgggaaatgtgtttggaatgaggagggtaaatgga
ctcaggcttgaggatctgtactttcctgaaaaaatcatacgggaatttaatgggccagca
tttggtattgaaggagttagaaaaatgcttgacataaaggaaaggccaatctacggtgtt
gtgcccaaaccgaaggttggctactctccagaggagctgtactctctcgctgaggagctt
cttttgtcaggggcagattttgtgaaagacgacgaaaatctggcatcgccctggtacaac
aggtttgaggaaagggcagaagtgatggcgaatatcatcgagaaagttgagaacgagacc
ggggagaaaaagacctggtttgcaaacataacaggtgatgtaagggatatggagtaccga
cttgaacttctgtcggagctttcactgaaacatgcaatggttgatgttgtcataagcgga
tgggctgtgcttgagtacataagggaccttgcagaggattacgacattgcgatacacggg
cacagggcgatgcatgcggcgatgacaagaaatccccggcacgggatttccatgttcgtt
cttgcaaaactgtaccggcttgtagggattgaccagcttcatgttggaactgcgggagca
ggaaagcttgaaggaaagaaatgggatgtgctgcagaacacaaaggttctgagggaaaat
cgctatgttcctgaagacggtgatgttttccacttggagcaaaagttttacggcataaaa
ccggctttccccacgagctctggagggctccatcccggcatactgccgaaggttattgag
gcgcttggcaccgacatagttcttcagcttggcggtggaaccataggacatccagacgga
ccgggttctggagcaagggcggtgagacaggctctggaggcgattgttcagaacatccct
cttgaagaatatgcaaagtcgcatagtgagctagcaagggcgcttgaaaagtggggaaca
gaaaccccaatttaa

DBGET integrated database retrieval system