KEGG   Geoglobus acetivorans: GACE_0283Help
Entry
GACE_0283         CDS       T03507                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gac  Geoglobus acetivorans
Pathway
gac00620  Pyruvate metabolism
gac00680  Methane metabolism
gac00720  Carbon fixation pathways in prokaryotes
gac01100  Metabolic pathways
gac01120  Microbial metabolism in diverse environments
gac01200  Carbon metabolism
Module
gac_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GACE_0283
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GACE_0283
   00680 Methane metabolism
    GACE_0283
Enzymes [BR:gac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GACE_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIY89339
UniProt: A0A0A7GBF3
LinkDB All DBs
Position
235095..236501
Genome map
AA seq 468 aa AA seqDB search
MSTQHPDNVEMPFFAKQSHFDGEDEIKEAYYVFSHLDIEEQMWDFEGKEVDDFVIKKLLS
TYPEFFRNNVIGQDVRITPRVPNPEVERDEAKLLAETLEMIPRSFDYARKFYDDPSPPIF
EIIVPMVTKSEELERIYLFYRDFVAGKSKLTLADGTRVGDWLGEFEPETIGVIPLFEDIP
AMLRCDEIAGEFADGKFDSMRVFLARSDPALNYGFIPATLAAKIALQKLYDLETDVHPII
GVGCPPFRGSFDPENMHALVEYPSVQTFTAQSAFKYDYDFGVARKAVEELRDSGPDKPQD
VEVDETIIQRLSAEYRRRVPQIAEFVNETGKFVPKRRMRKLHIGLFGYSRGDRVRLPRAI
TFCAVMYSIGFPPELIGISALGDKDYEDVCESIPTLESQMEFVLSHFNPESLRIVPFEDD
VKRAMELFDFEPREDYLIATGRTINSIRKQNGIGDAIIESGKLRRFLG
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccagcatccggacaacgtggaaatgccgttcttcgcgaagcagagccatttt
gacggagaggatgagataaaggaagcttactacgtcttctcccaccttgacatagaggag
cagatgtgggacttcgagggaaaggaggttgacgatttcgtgatcaagaagcttctgagc
acgtatcccgaatttttcaggaataacgtcatcggtcaggatgtgcggatcactccgaga
gttccaaatccggaagttgagagagatgaggcaaagcttctcgccgaaaccctcgaaatg
atccccagaagcttcgattacgccaggaagttctacgacgatccatcgccgccaatattc
gagataatcgttccgatggttacaaaatccgaggaacttgagaggatttacctgttctac
agggacttcgttgccggaaagtcaaagctgacgcttgcagacgggacaagggttggggac
tggctgggtgagttcgagcctgagacgattggagtgattccgctttttgaggacatcccg
gcaatgctgagatgcgacgagatagccggggagttcgcggacggaaagttcgactccatg
agggttttcctggcaaggtctgatcccgcactgaactatggcttcattcccgcgactctc
gcagccaagattgccctccagaagctctacgatctggaaactgacgttcacccgataatc
ggggtgggctgtccgccgttcagggggtctttcgacccggagaacatgcacgccctggta
gagtacccgtcggtgcagacgttcacagcccagtcggccttcaagtatgactacgacttc
ggagttgccagaaaagcggtagaggagctgagagacagcggtcctgataagccccaggac
gttgaggtggatgagacaatcatacagaggttgagcgctgaatacagaagaagagttccg
caaatcgcggagttcgtcaatgagaccggaaaattcgttcccaagaggaggatgaggaag
ctccacataggcctttttggatactcgagaggagatagggtaaggctcccgagagcgata
accttctgcgcggtcatgtactccataggattcccaccggaactgataggtatctccgcg
ctgggcgacaaggattacgaggacgtgtgcgagtccatcccaacactcgagagccagatg
gagttcgttctctcccacttcaatcccgaaagcctgaggatagtcccgtttgaggacgat
gtaaaaagagcgatggagctgttcgactttgaaccgcgtgaagactacctcattgcaacc
ggaagaaccataaactcaatcaggaaacagaacggaatcggagacgcgataattgaaagc
ggaaagctcaggaggtttctcggctga

DBGET integrated database retrieval system