KEGG   Geoglobus acetivorans: GACE_0743Help
Entry
GACE_0743         CDS       T03507                                 

Definition
(GenBank) Archaeal DNA polymerase I
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
gac  Geoglobus acetivorans
Pathway
gac03030  DNA replication
Brite
KEGG Orthology (KO) [BR:gac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GACE_0743
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gac03032]
    GACE_0743
Enzymes [BR:gac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     GACE_0743
DNA replication proteins [BR:gac03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     GACE_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_exo2 RNase_H_2 DNA_pol_B_2 Importin_rep
Motif
Other DBs
NCBI-ProteinID: AIY89792
UniProt: A0A0A7GFW2
LinkDB All DBs
Position
complement(636088..638433)
Genome map
AA seq 781 aa AA seqDB search
MEGWLIDADYVTEVGKAVVRLWCRDEEGVFVVYDRNFTPYFYVIPYQDFDPMDVKVESKG
KVVSPLKVEKARKKIFGKETEVYVVYARHPQDVPKLREVFRDYGDVREADIPFAYRYLID
RDLACMDGVRVEGDVRQEKGLRVVDAETVERVRKKTFPSLRVLAFDCEMLTEFGMADAEK
DPIIIIGVKMGDYEEIIHGEEREIIARFVKVIRELDPDIIVGYNQDGFDWPYLKKRAEKL
SVKLSVGRDGSELTFRGGRPKITGRLNVDLYDLAMRLDVKVKKLENVAEFLGRKVEIADI
EAKDIYRKWTSGDKESVFRYSRQDILNTYFIAEELLPMHYELSRMVRLPVDDITRIGRGK
QVDWLLLSEAYRLNELAPNPREMDEGYEGAFVLEPVRGLHENVYCLDFASMYPSIMIAYN
ISPDTYVSGACDDCFVAPEVNHRFRKQPDGFFKRILQDLIRRRREVKAMMGETDRDSIDY
RLLDIKQQTLKILTNSFYGYTGWSGARWYCRACAEATTAWGRHFIKKSAEIARSMGFEVL
YGDTDSLFVKKNDGLADSKEVEELIKRISKEIPITIEVDEIYRTIFFVEKKRYAGLTSDG
RLVVKGLEVRRGDWCELAKETQRSVIEIILKEMNPEKALKYVREVIGRIKSGEYPLEKYI
IYKGLTRKPSRYESVQAHVKAAKRGMELGYHYPVGTKVGFVVVEGSGNIGDRAYPLELIE
SFDGELVELKTKLGNEKKRIDREYYINNQIIPSVLRILERFGYNELTIKGNTQKTLDSFF
G
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggaaggctggctcattgatgcagattatgttaccgaggtaggaaaagcagtggtaagg
ctgtggtgcagggacgaggaaggagttttcgtagtgtatgacagaaatttcaccccctac
ttttacgtcattccttaccaagacttcgatccgatggatgtaaaggttgaatccaaggga
aaggtcgtatcccctctgaaggtggaaaaagccaggaaaaagatttttggcaaggaaact
gaagtttatgtggtttatgcacgccacccccaggatgtcccaaagctgagggaggttttc
agagactacggggatgtgagggaggcggacataccctttgcatacaggtatctgattgac
agggatcttgcatgcatggatggtgtgagggttgagggtgatgtcagacaggaaaaggga
ctgagggttgttgatgcagagaccgtcgagagagtgagaaagaagacgtttcccagtttg
agagttctcgcatttgactgtgagatgctgaccgagttcgggatggctgatgcagagaag
gacccgataataatcatcggagtcaagatgggtgattatgaggaaatcatacacggtgag
gagagggagataatagccagatttgtaaaggtgataagggagctggatcccgacatcatc
gttggttacaaccaggatggttttgactggccgtatttaaaaaagagagccgaaaagctc
tccgttaagctttcagttggcagagacggtagtgagctgactttcaggggtggtaggccg
aaaatcactggacggctgaatgttgacctctatgacctggcgatgagactggacgtcaag
gtcaaaaagcttgaaaatgtggccgaatttctgggcaggaaggtggaaattgcggacata
gaggcgaaggacatctaccggaagtggacctctggagataaggagagcgttttcagatac
tcgagacaggacatactcaacacgtattttatagccgaagaactccttccgatgcactac
gagctttccaggatggtcagactccctgtggacgacatcacaaggatcggcaggggaaag
caggttgactggttgcttctgagtgaagcgtacagactgaacgaactcgcaccaaatccc
agggaaatggatgagggttacgagggagcatttgtcctcgaaccggtcagaggtctgcat
gagaacgtttactgtctggatttcgcttcgatgtacccctccataatgattgcctacaac
atctctccagatacatacgtttcgggagcatgtgatgactgttttgttgcgcccgaggtt
aaccacaggttcagaaaacaaccagatggctttttcaagagaattcttcaggacctgatc
agacggaggcgtgaagtgaaagccatgatgggcgaaacagacagggacagcatcgactac
aggcttctcgacataaagcagcagacgctcaaaattctcacgaactcattttacggatac
acaggatggagcggggcaaggtggtactgcagagcatgtgctgaggcgacaacagcatgg
gggagacatttcataaagaaatctgcagagattgccagaagcatggggtttgaggtgctt
tatggcgatacggactcgctttttgtaaagaagaacgacggacttgcagacagcaaggaa
gtggaggagctgataaagcgcatctcgaaagaaataccaatcactattgaggtcgatgaa
atctaccgaacaatatttttcgttgaaaaaaagaggtacgccggacttacatcggacgga
agacttgttgtcaagggtcttgaagtcaggagaggagactggtgtgagcttgcgaaggaa
acccagaggagtgttatagagataatcctgaaagaaatgaatccggaaaaggctctcaaa
tatgttagagaggtgataggcagaataaagtccggtgagtacccccttgaaaagtacatc
atttacaaggggctgacaagaaaaccctccagatatgagagtgttcaggcacacgttaag
gctgccaagagaggaatggagcttgggtatcattaccctgtaggcacaaaggtgggattc
gtggttgttgagggttccggcaacatcggagacagagcctatccactcgaactgattgaa
agctttgatggagagcttgttgagctgaaaaccaaactcggcaacgagaagaagaggatt
gacagggagtactacataaacaatcagattatcccgagtgttttgaggatacttgagagg
ttcgggtacaacgagctgaccataaagggaaatacacaaaaaacccttgactcattcttt
ggctga

DBGET integrated database retrieval system