KEGG   Geoglobus acetivorans: GACE_0775Help
Entry
GACE_0775         CDS       T03507                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gac  Geoglobus acetivorans
Pathway
gac00030  Pentose phosphate pathway
gac01100  Metabolic pathways
gac01120  Microbial metabolism in diverse environments
gac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GACE_0775
Enzymes [BR:gac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     GACE_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AIY89825
UniProt: A0A0A7GCR5
LinkDB All DBs
Position
complement(666322..668223)
Genome map
AA seq 633 aa AA seqDB search
MVLNRKLGIIDLGKNRVLVREIPVELRKKHLGGRGLNWYYLYNSIRPDVDPYSPENVLAI
GAGLLTGFPALGAGRTQISTKNPMTGGVGDSNMGGAFGPQLRLAGFDHLLIVGRAEKPSY
ILVRDGGIEIRSAEHLWGLDTHTAQKVLREETGDDRAESMVIGRAGENLVSFANVMNGIK
NAGGRSGTGAVMGSKNLKAIVASGDIDLVVHDPEKLLDYALEVDRRARNTKWAKTLGRLG
TPLLYDVSYTTGFIGTLNWQYNTPGEDGKPLEAENLEKYSVKMVACIGCSVHCRHRVKIR
EGRYRGVVTEGPEYAAIGAFGTGVGVYDWEFVIKCNEMANKWGIDLISLGTTVAWAFELF
QRGYITENDTGGLRLEWGDENAVLELAKMIVERKNVGNVLADGMLKASEKFGKDSLYYAN
QTKGHPNLLTDERGIPSFALGIATSTRGADHLRSRPGIDLFQLPEETLERIYGHRIVSDF
TAYETKGIMVWWHELLYNVVDSLGICKFQTVFNSANSPRFEDYVPLIEFAAGIRMTKEDL
MEIGERNYTIERMFNVLNGFSRKDDYPPERYFREETKRGLPFMKGRKLDREKYDMMLEEY
YRQHGWDENGVPKRETLERLGISEPDYSILEVL
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggttcttaaccgaaagctgggaatcattgatctgggtaagaacagggttctggttaga
gaaatccctgttgagctgagaaaaaagcacctcggagggagagggcttaactggtactat
ctctacaattccatccgtcccgatgttgatccgtattctcctgaaaacgtccttgccatc
ggtgcaggtttgctgacgggatttccagcactcggtgctggaaggacgcagatctctaca
aaaaaccccatgacgggcggtgttggcgattccaacatgggtggtgcatttggaccacag
ctcaggcttgccggttttgatcacctcctcattgttggcagagctgaaaaaccatcttac
attctcgtcagagatggtggaatagaaatccggagtgctgagcatctctggggtctcgat
acccacacagcacagaaagtgctcagagaagagacaggagacgatagggctgagagcatg
gtgatcggtagggcaggagaaaatctcgtctctttcgccaacgtgatgaacggaataaag
aatgccggagggaggagcggcaccggggctgttatggggtcaaagaacctcaaggcgatc
gtggcgagcggagatatcgatctggtggttcacgatccagaaaaactccttgactacgct
cttgaagtggacagacgggcgagaaacaccaagtgggcaaaaactctgggacgtctcggc
acccctctgctttatgatgtgtcatataccacgggatttattggcacgctgaactggcag
tacaacactccgggagaggatggaaaaccgcttgaagcagagaatctcgagaaatacagt
gttaaaatggtggcatgcattggatgcagtgttcactgcaggcacagggtgaagatccgg
gagggcagatacagaggggttgtgaccgagggcccggaatatgccgccataggggcattt
gggaccggagtgggtgtttacgactgggagtttgtcataaaatgcaatgagatggcaaac
aaatgggggattgatctgatatctcttggaacaactgtcgcatgggcgtttgaacttttc
cagaggggctatataaccgagaatgacacaggcggtttgcggcttgagtggggcgatgaa
aatgcagttctcgagcttgcgaaaatgatcgtggaaaggaagaatgttggaaatgttctt
gctgacgggatgctgaaagcctctgaaaaattcggtaaggactcgctttactatgccaac
cagacaaaaggacatccgaacctgctgacggacgaaagaggaatcccaagcttcgctctt
ggaattgccacatccacgaggggggcagaccatttgaggagcagaccgggaattgacctc
ttccagcttcctgaggaaacccttgagaggatatacggacacagaattgtgagcgatttt
acggcttacgagacaaagggaataatggtgtggtggcatgaactgctttacaacgttgtt
gacagtctcgggatctgcaagttccagaccgtttttaactctgcaaactctccgagattt
gaggattacgtgcctctgatagagtttgcagcaggaatcaggatgacaaaggaggatctg
atggagattggtgaaaggaattacaccatcgagagaatgttcaacgttttgaacggattc
agcagaaaggacgactacccgcccgagaggtatttcagagaggagaccaagaggggttta
ccgttcatgaagggcaggaagcttgatagagagaagtacgacatgatgctcgaggaatac
tacaggcagcacggctgggatgaaaatggggttccgaagagggaaacgctcgaacggctc
gggatatctgagcctgattattcgattctggaggtgctgtga

DBGET integrated database retrieval system