KEGG   Geoglobus acetivorans: GACE_1561Help
Entry
GACE_1561         CDS       T03507                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gac  Geoglobus acetivorans
Pathway
gac03030  DNA replication
gac03410  Base excision repair
gac03420  Nucleotide excision repair
gac03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GACE_1561
   03410 Base excision repair
    GACE_1561
   03420 Nucleotide excision repair
    GACE_1561
   03430 Mismatch repair
    GACE_1561
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gac03032]
    GACE_1561
   03400 DNA repair and recombination proteins [BR:gac03400]
    GACE_1561
Enzymes [BR:gac01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GACE_1561
    6.5.1.6  DNA ligase (ATP or NAD+)
     GACE_1561
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GACE_1561
DNA replication proteins [BR:gac03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    GACE_1561
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     GACE_1561
DNA repair and recombination proteins [BR:gac03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GACE_1561
   NER (nucleotide excision repair)
    Other NER factors
     GACE_1561
   MMR (mismatch exicision repair)
    Other MMR factors
     GACE_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme DCD DNA_ligase_IV
Motif
Other DBs
NCBI-ProteinID: AIY90596
UniProt: A0A0A7GI39
LinkDB All DBs
Position
1301571..1303301
Genome map
AA seq 576 aa AA seqDB search
MSETLDNSNISPGTPIFMLTFSEFAELCQTVEKISSTLEKTARIAVFIREIEDENDLYNA
VLFLQGRIYPEWSERDLGVGVGLIYEAMRIATGIDRKTIENLIREKGDFGLAAEELVKKK
TQTLLFTEELTVKKLREIFDEISSLEGGGSQKKKILLLSELYSLCSPIEARYLTRLILRE
MRLGIGEGIIRDAIGKAFGIESEIVERAYMITNDFGKVAVEAKNGGKQALLSLKITPHIP
VKMMLAQVAESLEEATREIRELGVEWKFDGSRVQIHYADGRVTIYSRRLENVTNALPDIV
SEIKRCVKENVILDGEVIAVRDGRPMPFQHVLRRFRRKHGVSRMVEEIPLKVYLYDILYD
DGEVIDLPLKERRARLISAVGESDAVKVAEQIVTSDVRVIQQEFDRAIQAGHEGLMLKNL
ESKYIPGKRGKNWLKLKATMETLDLVVVGGEWGEGKRSNLISSFELACLDEYGGLLRVGK
VATGFTDEDLEELTELFKPEIEYQEGKRIVFNPKYVFEVAYQEIQKSPKYESGYALRFPR
FVRLRDDKSVEEADTVERVARLYEVQFRSKGGSWSS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagacattagacaacagtaatatatctcccggcacacctatttttatgctcaca
ttttcggaattcgctgagctctgtcagactgttgaaaaaatatcatccacccttgaaaaa
acagcaagaattgctgttttcataagagagattgaggatgaaaatgatctgtacaatgct
gtcctcttcctccagggaagaatttacccggaatggagcgaacgggatctgggcgtcgga
gtggggctgatttacgaggcaatgaggattgcaacagggattgacagaaagactatcgaa
aatctgataagagagaagggagatttcggtcttgccgcagaggaacttgtcaagaagaag
acccaaactctgctcttcaccgaggagctaacagtaaagaaattgagagaaatatttgac
gagatcagttcccttgaaggaggagggagccagaaaaagaaaatactgctgctctctgag
ctgtattcactctgcagtccgattgaagccagatacctgaccagactgatactcagggaa
atgaggctgggcataggagaggggataataagagacgcaataggaaaggcgtttggaatc
gagtctgaaattgtcgagcgggcatacatgatcacaaacgactttggaaaggttgcagtt
gaggcgaaaaatggcgggaaacaggcgttgctgtcccttaaaattactcctcacattcct
gtaaagatgatgctcgcccaggttgcagaaagccttgaggaggcgacgagagagataagg
gagcttggagtcgagtggaagtttgatggctcaagggtccagattcattacgccgatggt
agggttacaatctactcaaggagacttgaaaacgttacaaacgccctgccggacatcgtc
agtgagataaagaggtgcgtcaaggagaacgtcattctggatggtgaggttattgccgtc
agggatggaaggccaatgccgttccagcacgtgttgaggaggttcagaagaaagcatggc
gtgtccagaatggtggaggagattcccctgaaggtttacctgtacgacatcctgtacgac
gatggcgaggtaatagaccttccgctgaaggagagaagggcgagactcatttccgctgtc
ggtgagagtgatgctgtaaaggtggccgaacagattgtaacctcggacgtgagggtaatc
cagcaggagttcgacagggcaattcaggcaggtcacgaggggttgatgctgaaaaatctg
gaatctaaatacatcccaggtaaaagagggaagaactggctcaagctcaaggcgaccatg
gaaacattagaccttgtggtcgtaggaggagagtggggcgagggcaagagaagcaacctg
ataagctcatttgaacttgcatgcttagatgaatacggggggctgctcagagtgggtaag
gtggcaacggggtttacagacgaggatcttgaagagctgactgaactgttcaaaccagag
atcgagtatcaggagggaaaaagaatagtgttcaatccaaaatacgtcttcgaggtggcg
tatcaggagatacagaaaagccccaaatacgaaagcggctacgctctgagatttccgaga
tttgtcaggctcagagatgacaagagcgttgaggaggcagacacagtagaaagggtcgcg
aggctttacgaggtgcagttcaggagcaagggtgggtcgtggtcatcataa

DBGET integrated database retrieval system