KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0015
Entry
Glaag_0015        CDS       T01483                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03030  DNA replication
gag03410  Base excision repair
gag03420  Nucleotide excision repair
gag03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Glaag_0015
   03410 Base excision repair
    Glaag_0015
   03420 Nucleotide excision repair
    Glaag_0015
   03440 Homologous recombination
    Glaag_0015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gag03032]
    Glaag_0015
   03400 DNA repair and recombination proteins [BR:gag03400]
    Glaag_0015
Enzymes [BR:gag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Glaag_0015
DNA replication proteins [BR:gag03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     Glaag_0015
DNA repair and recombination proteins [BR:gag03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     Glaag_0015
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Glaag_0015
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N DNA_pol_A_exo1 5_3_exonuc DUF561
Other DBs
NCBI-ProteinID: AEE20984
LinkDB
Position
complement(16231..19017)
AA seq 928 aa
MSNSDPATTPVIPNNPFILVDGSSYLFRAFHGMPPLTNSKGQDTGAVYGVINMLRSLIKQ
FNPTHMAVVFDAKGKTFRDEIYTEYKANRPSMPEELRSQIAPLHKIIQAMGLPIIVESGV
EADDVIGTLADQASKLGIPTLISTGDKDMAQLVNEHVTLINTMNNQIMDPQGVVEKFGIP
PELVIDFLALKGDKVDNIPGVPGVGDKSAVGLLQGIGSINEIYQNLDKIATLDFRGAKKM
ADKMREYEEQARLSYTLATIKLDVEMDCSPTSLSPTEANYSELRDLFAELEFKRWLKEAT
DALSGNDQLSQADQSNDEPAQNTDIKANYHTILTQDALDDWLKKLHNAALFAFDTETTSL
NYMQAELVGMSFCIEEGEAAYLPLAHDYADAPEQLDRDSVLALFKPLLEDKNKAKVGQHL
KYDKNVLANYDINLQGIAYDTMLESYVLDSVATRHDMDSLAQHYLGLSTVHFEDIAGKGA
KQLTFNQIPLEQAAHYAAEDADITLRLHNHIWKKLNQSPELASVLSEIEVPLATVLAKME
QFGVLIDSQKLGQQSQDLASRILQLENEVHILAGEEFNLGSTKQLQEILFKKLDLPVLKK
TPKGAPSTSEEVLQELALTYPLPKLLMEFRVLSKLKNTYTDKLPKMINQRSGRVHTSYHQ
AITATGRLSSTEPNLQNIPIRTEQGRRVRQAFIPRPGYKIVAADYSQIELRIMAHLSQDK
GLLKAFSQGKDIHTATAAEVFNVSLEEVTTEQRRNAKAINFGLIYGMSAFGLSKQLNVSR
QDAQHYMDLYFERYPGVLKYMEDARVVAKEKGYVSTVFGRRLYLPDINASNGLRRKGAER
AAINAPMQGTAADIIKKAMLKVDAWIDTLPNDQTRMIMQVHDELIFEIKEQNVESDKNTI
VDLMEKAVSLDVPLIVEAGVGENWDEAH
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgagcaactctgatcccgctactacgcccgtcattcctaataacccatttatattagtt
gatggatcttcttatttgtttagggcttttcacggcatgccccctttaactaactctaaa
ggacaggacactggcgcagtctatggtgtgataaacatgctgcgtagcctgatcaaacaa
tttaaccccacacatatggctgttgtctttgatgccaaaggcaaaacttttcgggacgag
atctatacagaatataaagcgaaccgcccttcaatgcctgaagagctgcgcagtcaaatt
gcccctttgcataagatcattcaggcgatgggcttgcccattattgtagaatctggggtt
gaagccgatgatgtgatcggcaccttagccgatcaggcgagtaaacttgggatccctacc
cttatcagcacaggagacaaggacatggctcaactagttaatgagcatgtcacactcatt
aacaccatgaataaccaaataatggatccccaaggtgttgtggaaaaatttggtattccc
cctgagttagttatcgattttctggcgctcaaaggtgacaaagtcgataacattccagga
gttcctggcgttggcgataaaagcgcagtaggtctactgcaagggattggtagcatcaac
gagatttaccaaaacctcgacaaaatagccacgttggactttcgcggagccaagaagatg
gctgataagatgcgagagtatgaagaacaggctcgtctttcatacacattagcaaccatc
aaacttgatgttgaaatggattgcagcccaaccagtctttcaccaacagaggctaactat
agtgaactacgagatctattcgctgagctggagtttaaacgttggctgaaagaagcaact
gacgcactaagtggaaacgatcaactaagccaagcagatcaaagtaacgacgagccagca
caaaatacagatataaaagccaattatcacactatcttgacgcaagacgctctagacgat
tggttgaaaaaattacataacgcagcgcttttcgcttttgataccgaaacgaccagctta
aattatatgcaggcagagctcgtcggtatgtcattttgtatagaagaaggtgaagccgct
tacctccccctagcccacgattacgcagatgcgccagagcaattagatcgtgacagcgta
ttggccttattcaagcctttgttagaagacaagaataaagctaaggtcggacaacaccta
aaatacgataaaaatgtattagcgaattacgatatcaatcttcaaggtatcgcttacgat
acgatgctcgaatcatatgtgcttgatagcgtcgcaacccgacatgatatggatagctta
gcccagcattacttaggtctatcgaccgttcattttgaagatattgccggcaagggtgca
aaacaactaacgtttaatcaaattccgttagaacaagccgcacattacgctgctgaagat
gcagatatcacactaaggctgcacaatcatatttggaaaaagctaaatcaatcaccggaa
ctagcatctgtgttaagcgaaattgaagtgcctttagcaacggtactggctaaaatggag
cagtttggcgtgttaatagatagccagaaactcggtcaacaaagtcaggatcttgcctca
cggatccttcagctcgaaaacgaagttcatattttagcaggtgaagagtttaatctaggt
tcgactaaacaattacaagaaatactgtttaagaagttagacctacccgttttgaagaag
acaccaaaaggggctccatccacgtcagaagaggtactgcaagagttagcacttacatac
ccactacctaagctactgatggagtttagggtcttaagtaaattaaaaaacacatatacg
gataagctacctaagatgataaaccaacgcagtggacgcgttcatacctcatatcatcaa
gctattaccgcgacaggaagactatcgtctactgaacctaacttgcaaaatatcccgatt
agaacagagcaaggtcgcagagtacgacaagcgtttattcctcgaccaggctacaagatc
gtagcggcagattattctcaaattgaattgcggatcatggctcatctttcccaagataaa
gggttattaaaggcgttttctcagggtaaagacattcacaccgctaccgctgctgaagta
tttaacgtttccttggaagaggtgacaacagagcaaagacgcaacgccaaagccattaat
tttggtttaatttatggcatgtcagcattcggactatcgaaacagctaaatgtgtcacgc
caggatgcgcagcattatatggatctttactttgaacgttacccgggcgtacttaaatac
atggaagacgcacgtgttgtcgccaaagaaaaaggctacgtatcaaccgtatttggtcgt
cgtctttatttgcccgatattaatgctagcaatgggttacgacgcaaaggcgctgagcgg
gctgcaattaatgccccaatgcaaggtacagcagcagatatcatcaaaaaagcgatgtta
aaagttgatgcctggattgataccttgcccaatgatcaaaccagaatgattatgcaggtt
cacgatgaacttatttttgaaataaaagaacaaaatgtcgaaagcgacaaaaatactatc
gttgacctgatggaaaaagcagtttccttagatgtaccactgatagttgaagctggtgta
ggtgaaaattgggacgaagcccactaa

DBGET integrated database retrieval system