KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0056
Entry
Glaag_0056        CDS       T01483                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Glaag_0056
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gag03400]
    Glaag_0056
Enzymes [BR:gag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Glaag_0056
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Glaag_0056
DNA repair and recombination proteins [BR:gag03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Glaag_0056
SSDB
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS FbpA SBP
Other DBs
NCBI-ProteinID: AEE21025
LinkDB
Position
69480..70292
AA seq 270 aa
MPELPEVEVSRLGISPHLIGQQIKRVVVRHKQLRWLVPDEVHLAEGLRVNDVRRRAKYLF
IDTDAGSIILHLGMSGKLRIVNSDTPVIKHDHLDIVLANGVCLRFNDARRFGACLWQDVS
EPEIGMIAALGPEPLTADFDGQRLYDLSRTKSVAVKNFIMDNKVVVGVGNIYANEALFIA
GIDPRKAAKKVSKKTYLALGDIIKDVLAKAIEQGGTTLKDFTQADGNPGYFAQHLRVYGR
KGEACEVCASEIQSVTLGQRNTFFCEQCQT
NT seq 813 nt   +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaagtcagccgcttaggcattagccctcacttaattggc
cagcaaattaagcgggttgttgtgcgtcacaagcaattacgctggttggtacctgatgaa
gtacatctagccgaagggctgcgggtcaatgatgtgcgccgccgcgctaagtacttattt
attgatacggatgcaggcagcattattttgcacttaggcatgtcgggtaagttgcggatt
gtgaacagtgatacccccgttatcaagcatgatcatcttgatatcgtattagccaacgga
gtgtgcctgcgttttaacgacgcgcggcgctttggtgcttgcttgtggcaagatgtcagt
gaaccagagataggcatgattgcggccctcggtcctgagccactaacagcggactttgat
gggcagcgtttatatgatctttcccgcaccaagagtgtggccgtaaagaactttattatg
gataacaaagtggtcgttggggttgggaatatatacgcaaatgaagccttgtttatagcc
ggcattgatcccagaaaagcagctaaaaaagtcagcaaaaaaacgtacttggcgctcggt
gacattattaaagacgtcttggcgaaagccatagagcagggcggtacgaccttaaaagac
tttacgcaagccgatggcaaccctggatactttgctcagcacctgcgcgtgtatgggcgc
aaaggtgaagcatgtgaagtctgcgcgagtgaaatacagtcagttaccctagggcagcgt
aatactttcttttgtgagcagtgccaaacctaa

DBGET integrated database retrieval system