KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0078Help
Entry
Glaag_0078        CDS       T01483                                 

Definition
(GenBank) DNA ligase (ATP)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03030  DNA replication
gag03410  Base excision repair
gag03420  Nucleotide excision repair
gag03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gag00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Glaag_0078
   03410 Base excision repair
    Glaag_0078
   03420 Nucleotide excision repair
    Glaag_0078
   03430 Mismatch repair
    Glaag_0078
Enzymes [BR:gag01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Glaag_0078
    6.5.1.6  DNA ligase (ATP or NAD+)
     Glaag_0078
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Glaag_0078
DNA replication proteins [BR:gag03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Glaag_0078
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Glaag_0078
DNA repair and recombination proteins [BR:gag03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Glaag_0078
   NER (nucleotide excision repair)
    Other NER factors
     Glaag_0078
   MMR (mismatch exicision repair)
    Other MMR factors
     Glaag_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEE21047
UniProt: F4AHB8
LinkDB All DBs
Position
complement(94347..95198)
Genome map
AA seq 283 aa AA seqDB search
MSIYTRLYTCLVLIYLICIPLSHAFAQHKPEIELANRFNDSVNVAEYLVSEKLDGIRARW
DGTQLLTRSGNPISAPIWFVERLPKHVLDGELWIGRQRFERTASVVLSHEPSDGWREIKF
MLFDLPGYTGPFSERLRMLEVLAMQANLGHMQVIPQRKYSNHSALMAALDEVSRGGGEGL
MLHHQDALYTPLRSNNVLKLKKHRDAEAIVLAHLPGNGKYQGMMGAIRVQMSNGKVFKIG
SGFSDQERRSPPPVGSVVTFKYYDLTVNGIPKFASYIRRKPRQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttatacccgcttatatacctgcttagttttgatctatttaatatgtatcccg
ctctcccacgcgtttgcgcaacataaacctgaaatcgagctagctaatcgctttaatgac
tctgttaacgtagctgaatatttagttagcgagaaattagatggcattcgagctcgctgg
gatggcactcagttgctcacccgctcaggtaaccctatatccgcgccgatatggtttgtt
gagagattacctaaacatgttctcgacggtgagctgtggataggccgtcagcgttttgag
agaaccgcttctgtcgtactcagtcacgagccaagcgacggctggcgggaaataaaattt
atgctgtttgatttgcccggctacacaggtcctttcagtgaacgcttgcgaatgctcgag
gtgttagcaatgcaggcaaacttgggtcatatgcaggtgatcccccagcgcaagtattcc
aatcattcagcactaatggcggcgctagatgaagtttctcgtggtggcggtgaaggcttg
atgttacatcatcaagatgcgctatatactcctttgcgcagcaacaatgtgttaaagctt
aaaaagcatcgcgatgctgaagctattgtattagcgcacttacctggaaacggtaaatac
caaggtatgatgggcgctattcgcgtgcaaatgagtaatggcaaagtgtttaaaatcggc
agcgggttttccgaccaagagcgtcgttcccctccccctgtcggctcagtcgtgaccttt
aagtattatgacctaaccgttaacgggatccctaaatttgccagttatattcggcgaaaa
ccaaggcaataa

DBGET integrated database retrieval system