KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0081Help
Entry
Glaag_0081        CDS       T01483                                 

Definition
(GenBank) A/G-specific adenine glycosylase
  KO
K03575  A/G-specific adenine glycosylase [EC:3.2.2.31]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Glaag_0081
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gag03400]
    Glaag_0081
Enzymes [BR:gag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.31  adenine glycosylase
     Glaag_0081
DNA repair and recombination proteins [BR:gag03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Glaag_0081
 Prokaryotic type
     Glaag_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX_4 HhH-GPD HHH EndIII_4Fe-2S Whib Opy2
Motif
Other DBs
NCBI-ProteinID: AEE21050
LinkDB All DBs
Position
complement(98137..99201)
Genome map
AA seq 354 aa AA seqDB search
MQSQSQLTSSFANRILSWFDSHGRKDLPWQQGKTPYSVWVSEIMLQQTQVKTVIPYYQKF
MQRFPDILTLANAPQDEVLHHWTGLGYYARARNLQKAAQVIRDQYDGKFPQDINDVIALP
GVGRSTAGAVLSLACAQHHSILDGNVKRVLARYFAVDGWPGKKDVEQALWQYADSLTPNS
RTGDYTQAMMDMGATICTRSKPKCDSCPLQQNCLAFAQGRQSELPGKKPKKDIPVRTTVM
LIPMWQSQVLIYQRPPSGLWGGLWGFYEADSLDTLDATAQQLALGQYTRLTLEPFRHTFS
HFHLDIQPVILQLEQPSSSQVNEKQQIWYDLLKQPNVGLAAPTKKLLAVCKTQL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatcacagtctcagctaacatcttctttcgcaaaccgtattttatcttggtttgat
agccatggtcgcaaagacttaccttggcagcaagggaaaaccccttactcagtgtgggtt
tcagaaattatgttgcaacaaacccaagtcaaaacggttattccctactatcagaaattt
atgcaacgctttcctgatattttgaccttagccaatgccccccaagacgaagtgctacat
cactggaccgggctaggctattacgcccgcgcacggaacttacaaaaagcggctcaagtc
attcgtgaccaatatgacggtaaattccctcaagacattaacgatgtaatcgcattgcca
ggcgttggccgctccactgctggagcggtgctctctttagcatgcgcacagcatcacagt
attttagatggcaatgtaaagcgtgtgctagcgcgctattttgccgtcgatggctggccc
ggcaagaaagacgtcgaacaagcattatggcaatatgcagactccctcacccccaattca
cgcacaggtgactatacccaagccatgatggatatgggcgccaccatttgcacccgcagt
aaacccaagtgtgatagctgcccattgcaacaaaattgcttggcttttgcccaaggccgg
caaagtgaattgcctggtaaaaaacctaagaaagatattcccgtgcgcaccaccgtgatg
ctcatccctatgtggcaatcacaggttttgatttatcaaagaccacccagtggtttatgg
ggcggcctatggggtttctatgaagcagactcattagatacgcttgatgccacagcgcag
caattagcgttaggccagtatactcgtctcacgcttgagccttttcgtcatacatttagt
cacttccacttagatattcagcccgttattttgcaacttgaacaaccgtcatcatcacag
gtgaacgaaaagcaacaaatttggtacgacttgctgaaacaaccaaacgtcggcttagcc
gcccccactaagaaattacttgcagtgtgcaagacccagctttag

DBGET integrated database retrieval system