KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0088Help
Entry
Glaag_0088        CDS       T01483                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gag00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Glaag_0088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gag02022]
    Glaag_0088
Two-component system [BR:gag02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   Glaag_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AEE21057
UniProt: F4AHC8
LinkDB All DBs
Position
105713..106420
Genome map
AA seq 235 aa AA seqDB search
MLTPNILIVEDEVVTRTTLKSLFEAEGYNVFEAENGSEMHEFFENHAINLVIMDINLPGK
NGLILAREVRDRKNIGLIFLTGRDNDVDRILGLEIGADDYLTKPFNPRELTIRARNLLTR
TLNNAEDDDLPSRVSFNGWTLDGDSRSLISPSKKEFRLPRSEFRALHLFLSNPGKILTRE
QLIMEMTGRELRPNDRTVDVTIRRIRKHFESEVNADELIVTIHGEGYRFCGTVDV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgcccaatattttaattgtagaagatgaagttgttaccagaacaacactcaaa
agcctgtttgaagcagaaggctacaatgtatttgaagccgagaacggcagtgaaatgcat
gagttttttgaaaatcacgcaatcaacctagtgatcatggatatcaaccttccgggtaag
aacggtttgattttggctcgcgaagtgcgtgatcgtaaaaatatcggtttgatattttta
actgggcgcgataatgacgtggaccgtattttgggtcttgaaattggcgctgatgattat
ttaactaaaccgtttaatccgcgggaattaaccatcagagcaagaaacttgctaacgcgt
actttgaataatgcagaagatgatgacttgccaagtcgtgtaagcttcaacggttggact
ctggacggcgatagccgtagcttgatttcacctagcaagaaagagtttagactaccgcgc
agtgaattccgtgcgttgcatttattcttaagcaaccctggcaaaatattaacgcgtgaa
cagttgatcatggaaatgaccggccgtgaattacgccctaatgaccgtacagttgatgta
acgattcgacgtatccgtaagcacttcgaatcagaagtgaatgcagacgaattgatcgtg
accattcacggcgaaggttaccgtttctgcggaacggttgacgtatag

DBGET integrated database retrieval system