KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0846Help
Entry
Glaag_0846        CDS       T01483                                 

Definition
(GenBank) UDP-N-acetylmuramate/alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00471  D-Glutamine and D-glutamate metabolism
gag00550  Peptidoglycan biosynthesis
gag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Glaag_0846
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Glaag_0846
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gag01011]
    Glaag_0846
Enzymes [BR:gag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     Glaag_0846
Peptidoglycan biosynthesis and degradation proteins [BR:gag01011]
 Precursor biosynthesis
  Amino acid ligase
   Glaag_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AEE21809
UniProt: F4APE6
LinkDB All DBs
Position
990805..992259
Genome map
AA seq 484 aa AA seqDB search
MIAPDKVHYHVPEMRRIKNIHFVGIGGAGMGGIAEVLLNEGYQVSGSDRQANGMTNRLAA
LGATIFFGHQASNVEQANVVVVSSAIDPTNPEVNAANEKRIPVIRRAEMLAELMRFRHGI
AIAGTHGKTTTTSLIATIFAQAELDPTFVIGGLLNSAGTNARLGSSQYLIAEADESDASF
VHLQPMVSVVTNIEPDHMETYQGDFDKMQDTYIDFLHNLPFYGLAVLCIDDPVITELLPR
IKRKYLTYGYSENADVRATNVKHRFNQSEFTLIRKDHDDIQVTVNAPGKHNVLNSLAAIA
VATDENIADSAIKTALANFSGIGRRFEMLGEFATGDGDVLLVDDYGHHPTEVEATIAVAR
NNWPDRRLVMAYQPHRYSRTRDLYEDFVRVLSQVDVLLLLDVYSAGEEKIEGADSKSLCR
SIRQRGQLEPIYVADKSELPKLLADNLSDQDILMTQGAGNIGQIAKQLQDMKLAKSTLRE
GWSK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacccgataaagttcattaccatgtgccagagatgcgccgaattaagaatatt
cactttgtgggtataggcggtgcaggcatgggcggcattgctgaagtgttattaaacgaa
gggtatcaagtatcaggctctgatcgccaagccaatggtatgactaaccgtttagcggcc
ttaggggcgactattttctttggtcatcaggcgtcaaacgtcgaacaagccaatgtggtt
gtggtatccagtgcgattgacccaaccaacccagaagtaaacgcggcaaacgaaaagcgt
attcccgttattcgcagagcggaaatgctggctgagttgatgcgctttaggcatggtatc
gccatcgctggaacgcatggtaaaaccactaccacgagtttgattgcgaccatctttgca
caagcagagcttgatcctacgtttgtgatcggaggcttgctcaatagtgctggcaccaat
gcaagactgggttcaagtcagtatttaattgctgaagcagatgaaagcgatgcatcgttt
gtgcacctgcagcctatggtatctgtggtaacgaatatcgaaccagatcacatggaaacc
taccaaggtgatttcgataagatgcaagatacctacatagactttctgcacaatttacca
ttttacgggttagcagtgctgtgcattgacgatcctgtcattaccgaactgctaccgcgg
ataaagcgcaaatacctgacgtatggttacagtgaaaacgcagatgtgcgcgctactaat
gttaagcacaggttcaatcaaagtgaatttaccttaatacgtaaagatcatgacgatata
caagtgactgttaacgccccaggtaagcacaacgtgcttaactcactggccgcaattgcc
gttgcaaccgatgaaaatatcgctgattcggcgattaaaacagcattagctaacttctct
ggcattggtcgacgctttgaaatgctaggtgaatttgctaccggtgatggtgatgtactg
ttggtggatgattacggtcatcacccgactgaggtggaagcgaccatagccgttgcacgt
aataattggcctgacagaagactagtgatggcataccagcctcatcgttattctcgaacc
cgagatttatacgaagattttgtccgagtcttatctcaggtcgatgtgctgttattactt
gatgtttattctgctggtgaagagaaaatagagggggcagacagtaagtctttatgccgg
agtattcgtcagcgtggccagcttgaaccaatttatgtggctgacaaaagcgaactacct
aaattattggcagataatttaagtgatcaagatattttgatgacccaaggggcgggaaat
atcgggcaaatcgccaagcaactacaagatatgaaattagcaaaaagcacgttacgtgaa
gggtggtcgaagtga

DBGET integrated database retrieval system