KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0847Help
Entry
Glaag_0847        CDS       T01483                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00473  D-Alanine metabolism
gag00550  Peptidoglycan biosynthesis
gag01100  Metabolic pathways
gag01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Glaag_0847
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Glaag_0847
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Glaag_0847
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gag01011]
    Glaag_0847
Enzymes [BR:gag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Glaag_0847
Peptidoglycan biosynthesis and degradation proteins [BR:gag01011]
 Precursor biosynthesis
  Amino acid ligase
   Glaag_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEE21810
UniProt: F4APE7
LinkDB All DBs
Position
992256..993236
Genome map
AA seq 326 aa AA seqDB search
MTSINATNTNAIDVDAIESKDPAGFGKVAVMFGGRSAEREVSLRSGQAVLNALVGAGVNA
HGFDPADRQLHELVEQKFDRVLIMLHGRGGEDGSLQGALQQMNMPYTGTGVLGSALCMDK
IRSKQVWQSLGLPTANYEIADKRDFNAANCGDIMTRLGDLVMVKPAQEGSSIGMAKVSNA
HQLAAAIQQAFEYDDKVLLEQFIQGSEYTVSLLNGIALPSISMSTPRDFYDYEAKYQSNS
TEYFCPSGLSDEQETDLAQLALNAFDAVAGTGWGRIDFMQDAQGQFYLLEANTVPGMTEK
SLVPLAAKQAGLSFAQLSLAVLATAG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcaatcaacgcaacaaacacaaatgcaatagacgtagacgcaattgaaagcaaa
gatccagctggttttggaaaagtcgccgttatgttcggaggtcgctctgctgaacgagag
gtttcattgcgctcaggtcaagctgtgctcaatgcacttgtcggtgcgggtgtgaacgcc
catggttttgatcctgctgatcgtcagttacatgaattagtggagcaaaagtttgaccgc
gtactgattatgttacatggccgaggtggtgaagatggctctcttcagggggccttacaa
caaatgaatatgccttacactggcactggtgtgctgggttcagccttgtgcatggataaa
atacgcagtaagcaagtttggcaaagcttggggttacctactgccaattacgaaattgct
gataaaagagactttaatgcagcgaactgcggggatataatgacccgcttaggggatctg
gttatggttaagcccgctcaagaaggttcgagcataggcatggctaaggtttcaaatgcg
catcaactcgctgcagcaattcaacaggcttttgagtatgacgataaggttttgttggaa
caattcatccaaggttcagagtacaccgttagcctattaaatggcatagcgttgccctca
atcagcatgtcgactccacgagatttttacgattacgaggcaaagtatcagtcaaattcg
actgagtatttttgccctagtggtttatctgatgagcaggaaactgacttagcacaattg
gctttgaacgcgtttgatgctgttgcgggcacagggtggggaagaattgattttatgcaa
gacgcacaaggtcagttttatttgcttgaagccaatacagtacccggcatgacagaaaag
agtttggtaccactagccgctaagcaagcgggtttgagttttgcgcagttatcacttgct
gtgttagcgacggcaggttaa

DBGET integrated database retrieval system