KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0970Help
Entry
Glaag_0970        CDS       T01483                                 

Definition
(GenBank) Beta-ketoacyl synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00061  Fatty acid biosynthesis
gag00780  Biotin metabolism
gag01100  Metabolic pathways
gag01212  Fatty acid metabolism
Module
gag_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Glaag_0970
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Glaag_0970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gag01004]
    Glaag_0970
Enzymes [BR:gag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     Glaag_0970
Lipid biosynthesis proteins [BR:gag01004]
 Fatty acid synthase
  Component type
   Glaag_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc CaMKII_AD
Motif
Other DBs
NCBI-ProteinID: AEE21931
UniProt: F4AQL3
LinkDB All DBs
Position
1141863..1143173
Genome map
AA seq 436 aa AA seqDB search
MRYAKEQTSYIAKIVTICGNFKSGNFLLEGFIMRRAVITGLGIVSSIGNNKTEVTKSLRE
GRSGITYSEEFAENGMRSHVWGKVNLDLSEHIDRKTLRFMGDAAGYAYIAMQQAVEDSGL
TPEMVSNVRTGIIAGSGGASSQHQVGAVDILREKGLRRVGPYMVTRCMGSTVSACLATPF
KIKGVNYSISSACSTSAHCIGNALEQIQLGKQDIIFAGGGEELHWTLSMEFDAMGALSTK
YNDNPSTASRTYDANRDGFVGAGGGGMVVVEELEHALARGAKIYGEIVGYGATSDGADMV
APSGEGAIRCMQQAMNGVDEPIDYINTHGTSTPVGDVKELWAIGEVFGDKVPPLSATKAM
TGHALGAAGVNEAIYSLLMMENDFIAPSINIETLDEAAQGMDVVTETRDAKLNTVMSNSF
GFGGTNCTLVMQRYKG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttgcgttacgcaaaagagcagaccagttacatcgcgaaaatcgttaccatatgcggcaat
tttaaaagcggcaattttttgcttgaagggtttatcatgagaagagcggttatcaccggg
ctaggcattgtttctagcattggtaacaacaaaactgaagtcacgaaatctcttagagaa
gggcgttctggcatcacttattctgaagaatttgctgaaaatggcatgcgcagccatgta
tggggcaaggttaatcttgacttatctgagcatattgatcgtaaaacgctacgcttcatg
ggcgatgcggctggctatgcgtacattgcgatgcagcaagcggtagaagattcaggtttg
acaccagaaatggtttcaaacgttcgcaccggtatcattgccggctcaggcggtgcgtct
tctcagcatcaagttggcgcagttgatattttgcgcgaaaaaggtttacgtcgtgttggc
ccttatatggtcacgcgctgtatgggcagtactgtgtctgcttgtttagccacaccgttt
aaaattaaaggtgttaactactcaattagttcagcctgttcaaccagtgcgcactgtatt
ggtaatgctctagagcaaatccagcttggtaagcaagacattatttttgctggtggcggt
gaagagctgcactggactttatcaatggaatttgacgccatgggcgcactttcaactaaa
tacaatgacaacccaagcacggcatcgcgcacttatgatgcgaaccgtgatggtttcgtt
ggtgctggcggtggcggtatggttgtagttgaagaactagaacatgccttggcccgtggt
gcgaaaatttacggcgaaattgtaggttatggcgcaacatctgatggcgcagacatggtt
gcaccatcaggcgaaggcgctattcgttgtatgcaacaagcaatgaacggcgtggacgaa
ccaattgattatatcaacacgcatggtacttcaactcctgtaggcgatgtaaaagagcta
tgggccatcggtgaagtgttcggcgacaaagttccgccactgagtgcaacaaaagcgatg
acaggccatgcattaggcgctgccggtgttaacgaagctatctacagtttattgatgatg
gaaaacgactttattgcgccttctatcaacattgaaactttagatgaagcggcacaaggt
atggacgtggtgaccgaaacccgcgatgccaagttaaatacggttatgtcaaatagcttc
ggctttggtggcacaaactgtactttggtgatgcaacgctacaaaggctag

DBGET integrated database retrieval system