KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1354
Entry
Glaag_1354        CDS       T01483                                 

Definition
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Glaag_1354
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gag03400]
    Glaag_1354
Enzymes [BR:gag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Glaag_1354
DNA repair and recombination proteins [BR:gag03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Glaag_1354
 Prokaryotic type
     Glaag_1354
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: AEE22314
LinkDB
Position
complement(1571385..1572017)
AA seq 210 aa
MNQQKRIEMLTRWRAANPHPTTELNFTSPFELLIAVLLSAQATDVSVNKAMAKMFPVANT
PETVYALGVDGVKEFIKTIGLFNTKAVNVNKTCKMLIDKHNSVVPEDRAALEALPGVGRK
TANVVLNTAFGWPTIAVDTHIDRVSNRTKFAMGKTVEKVEEKLLKVVPAEFKVDVHHWLI
LHGRYTCIARKPRCGSCIIEDLCEFKDKTE
NT seq 633 nt   +upstreamnt  +downstreamnt
atgaaccaacaaaagcgtatagaaatgttaacccggtggcgtgccgctaacccccaccct
acaacggaattaaactttaccagtcccttcgagctgctgattgcggtattgctttccgct
caggcaacagatgtcagcgtgaataaagccatggcgaaaatgttccctgtagccaacacc
ccagaaacggtttatgccttaggcgtggatggcgtaaaagagtttatcaagaccatcggg
ctgtttaataccaaagcggtcaatgtgaacaaaacctgtaaaatgcttatcgacaagcat
aacagtgtggttcctgaagaccgagcagcgcttgaggcgttacctggtgtgggccgtaaa
acggcaaacgtagtactgaacactgcctttggctggccgaccatagctgtcgacacccat
attgatcgcgtaagcaaccgcaccaaatttgccatgggtaagaccgtcgaaaaagtagag
gaaaaactgttaaaagtcgtacctgctgaatttaaggttgacgtgcaccactggttaatt
ttacacggccgctatacttgtattgccagaaaacctagatgtggttcttgtattatcgaa
gacttgtgtgagttcaaagataaaaccgaataa

DBGET integrated database retrieval system