KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_1626
Entry
Glaag_1626        CDS       T01483                                 

Definition
(GenBank) exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Glaag_1626
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gag03400]
    Glaag_1626
Enzymes [BR:gag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     Glaag_1626
DNA repair and recombination proteins [BR:gag03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     Glaag_1626
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Other DBs
NCBI-ProteinID: AEE22582
LinkDB
Position
complement(1883861..1884670)
AA seq 269 aa
MKIISFNINGIRARLHQLKALIDKHQPDIIGLQEIKVHNDMFPVADVEAMGYKVYFHGQK
AHYGVAMLCKEEPSDVQYGFPTDDEDAQRRMIMVSYPMPNGETVRVLNGYFPQGENRSHE
TKFPAKRKYYEDLSTYLNTHHTPDENVVVMGDVNISHTDLDIGIGEPNRKRWLQTGKCSF
LPEERLWLNDLIDWGFSDGFRTLNPETNEHFSWFDYRSKGFLDNRGLRIDLILATKKLHE
SLSDAGIDYELRGIEKPSDHAPIWAEYKD
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaaaataatttcttttaacatcaatggtatacgtgcccgtcttcatcaactaaaggca
cttatcgacaaacatcaacctgatattatcggcctgcaggaaattaaagtgcataacgat
atgtttccggtggccgacgtggaagctatgggttacaaagtgtattttcatggtcaaaaa
gcacattacggcgtggcaatgttgtgtaaagaagagccttctgatgttcaatatgggttc
ccgacagatgatgaagacgcccaacgacgcatgatcatggtcagctaccctatgcctaac
ggtgaaacggtgcgtgtattgaatggatactttcctcagggcgagaaccgttcacacgaa
accaaatttccagccaagcgcaaatactacgaagatttatcgacttatttaaatacccat
cacacaccagatgagaacgttgttgtaatgggcgatgtgaatatttcgcacactgattta
gatataggcataggtgaaccaaaccgtaaacgttggttacaaacaggtaaatgcagtttt
ttaccggaagagcggttatggctgaatgatttgattgactggggctttagtgatggattt
cgtactttgaatccagaaacaaacgagcactttagctggtttgattatcgctcaaagggc
tttttagataaccgtggtttacgtatcgacttaatattagccactaaaaaattacatgaa
tcgctcagtgatgccggcattgattacgagctgagaggcattgaaaagccatctgatcac
gcgcctatttgggctgaatacaaagattag

DBGET integrated database retrieval system