KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_2668Help
Entry
Glaag_2668        CDS       T01483                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag00071  Fatty acid degradation
gag00280  Valine, leucine and isoleucine degradation
gag00281  Geraniol degradation
gag00310  Lysine degradation
gag00362  Benzoate degradation
gag00380  Tryptophan metabolism
gag00410  beta-Alanine metabolism
gag00640  Propanoate metabolism
gag00650  Butanoate metabolism
gag00903  Limonene and pinene degradation
gag00930  Caprolactam degradation
gag01100  Metabolic pathways
gag01110  Biosynthesis of secondary metabolites
gag01120  Microbial metabolism in diverse environments
gag01130  Biosynthesis of antibiotics
gag01200  Carbon metabolism
gag01212  Fatty acid metabolism
Module
gag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Glaag_2668
   00650 Butanoate metabolism
    Glaag_2668
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Glaag_2668
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Glaag_2668
   00310 Lysine degradation
    Glaag_2668
   00380 Tryptophan metabolism
    Glaag_2668
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Glaag_2668
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Glaag_2668
   00281 Geraniol degradation
    Glaag_2668
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Glaag_2668
   00930 Caprolactam degradation
    Glaag_2668
Enzymes [BR:gag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Glaag_2668
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Glaag_2668
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Glaag_2668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AEE23608
UniProt: F4AJ32
LinkDB All DBs
Position
complement(3125016..3127169)
Genome map
AA seq 717 aa AA seqDB search
MMTNENTTEQHAPSAFTLTKRDDGIAILSMDVPGETMNTLKVEFGDQVGAMLDQIESDSS
IKGVVVISGKDNSFVAGADISMLAGCKSAEEAQAIGQGGQAVFQRIEDMSVPFVAAIHGP
ALGGGLELALACHMRVCSDDDKTQLGLPEVQLGLLPGSGGTQRLPRLISVQQAMKMMLTG
SAVRAKQAKKYGIVDDMVPRSILLDVAIEMAKKSKPKRKPVKLDLMGQFLERTPMGRKLM
FKQARKQTQAKTLGNYPSPERIIDCIETGLEKGNAQGYALEAQHFGHLVMTPESAALRSL
FFATTEMKKENGVEGVAPNALKKIGVLGGGLMGGGIAFVTATKAKLPVRIKDIRSDGIAH
AMKYSYDILSKKVKRRFMLHSQMQSQLSRLTGSVDYVGFDNTDVVIEAVFEDLALKQNMV
ADVETHCSEHTIFASNTSSIPIGQIAANAKRPENVIGLHYFSPVDKMPLAEVIAHEGTSD
QTISTTVELAKKQGKTPIVVKDGAGFYVNRILAPYMNESAEILLAGEPIEQIDRALVKFG
FPVGPIKLLDEVGIDVGTKISPILVAEFGERFSSAPGFDKLLADDRKGKKNKRGFYNYEG
KKPGKEVDESVYDLLGITPSSRLSESTIAERCVLLMLNEAAMCLDEGVVRSARDGDIGAI
FGIGFPPFLGGPFRYMDSLGIQQVVERLSHYQQQFGDKFTPAKCLVEMAENNATFYS
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatgaaaatacaacagagcaacatgccccaagcgcgtttacccttaccaaa
cgtgatgatggtattgctattctaagtatggatgtacccggggaaaccatgaatacgctc
aaagttgagtttggtgaccaagtaggagccatgcttgaccagattgagagcgacagcagt
attaaaggtgtggttgttatcagtggaaaagacaactcttttgtagcaggtgccgatatt
tcgatgcttgcagggtgtaaaagtgctgaagaagcacaagcaataggccaggggggacaa
gctgttttccaacgtatcgaagatatgtcggtgccgtttgttgctgcaatccacggacct
gcattaggcggaggtttagagctggcacttgcttgccacatgcgagtgtgtagtgacgat
gacaagacccaactaggcttacccgaagttcaattaggcttgttgccaggcagtggcggc
acgcaacgtctgccgcgtttgatcagtgtacagcaggccatgaaaatgatgctgacaggg
tcggcggtacgagcaaaacaagcgaaaaaatacggtattgtggatgacatggtgccacgt
tcgattttacttgatgtggccattgaaatggccaagaaaagcaagccgaaacgtaaacca
gtcaagcttgatcttatggggcagtttcttgagcgcacccccatgggcagaaaattaatg
ttcaaacaagcgcgtaagcaaacccaagccaaaacgctgggtaattacccctcacccgag
cgtattatcgattgtatcgaaacaggtttagaaaaaggtaatgcacaaggctacgcccta
gaagctcagcattttggtcatcttgtgatgacacctgaatcagccgctctacgcagtttg
tttttcgccacgactgaaatgaaaaaagagaacggcgttgaaggtgttgctcctaacgca
ttgaagaaaattggtgtgttaggtggtggcctaatgggtggtggtatcgcctttgtcaca
gcaacaaaagcgaaattgcccgtacgcattaaagatatccgcagtgatggcattgcccat
gcgatgaaatactcttatgacattttgagcaaaaaagtgaaacgccgcttcatgttgcat
tcccaaatgcaatctcagctttcgcgtttaacaggctctgttgattatgtaggtttcgac
aatacggatgtagtgattgaagcggtttttgaagatctagcattaaaacaaaatatggtt
gctgacgtggaaacacattgttcagagcacactatttttgcttcgaatacctcgtcgatt
ccaattggtcaaattgctgccaatgctaagcgcccagaaaatgttattggcctgcactat
ttttctccagtagacaaaatgccactggctgaagtcatcgcccatgaaggaacgtctgat
cagactatttcaacaacggttgagctagcgaaaaagcagggcaagacacccattgttgta
aaagacggagcaggcttttatgttaaccgtatattggcgccgtatatgaatgagtcggcc
gaaatattattagccggcgagccgattgagcaaattgatagagccttggtgaaatttggt
ttcccagtcggacctatcaagctgctagatgaagttggcattgatgtggggacgaagata
agcccgattttagttgctgagtttggtgagcgttttagttcagccccaggattcgacaaa
ttattggcggatgacagaaaaggcaagaagaacaaacgtggcttttacaattatgaaggt
aaaaaaccaggcaaagaagtcgacgagagtgtctatgatttattaggtattacaccaagt
agccgtttaagtgaaagtactattgcagaacgctgcgttttattaatgctaaacgaggct
gcaatgtgtctcgatgaaggtgtggtgcgcagtgccagagatggagatataggtgctata
ttcggtattggtttcccgccgttcttaggtgggccgtttagatacatggatagtttaggt
attcaacaggtcgtagaacgtttaagccattaccaacaacaatttggtgacaagtttacg
ccagctaagtgcctagtagaaatggctgagaataacgccaccttctacagttag

DBGET integrated database retrieval system