KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3001Help
Entry
Glaag_3001        CDS       T01483                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Brite
Enzymes [BR:gag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Glaag_3001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEE23937
UniProt: F4AN42
LinkDB All DBs
Position
3496770..3497351
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYEKNALEPHISAETLEYHYGKHHATYVSKLNGLVEGTDMANKDLEEIVKSS
EGGVFNNAAQIWNHTFYWNSLSPNGGGEPTGALADAINAKWGSFADFKAALNDKAVNNFG
SSWTWLVKTADGSLDIVNTSNAGTPLTDASLTPLLTVDLWEHAYYIDYRNARPKYLEGFW
ALANWDFAASNFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattaccagctcttccgtatgaaaagaatgctttagaaccacatatctca
gctgagacattggaatatcactacggcaagcatcacgccacgtatgtttctaagctaaac
ggcttggttgaaggtactgatatggcgaataaagatcttgaagagatcgtaaaatcgtct
gaaggcggagtgttcaataacgctgctcaaatctggaaccacacgttctactggaacagc
ctaagcccaaatggtggcggtgaaccaactggcgcacttgctgacgcaatcaacgccaaa
tggggttctttcgcagactttaaagcagccttgaacgacaaagcagtgaacaactttggt
tcaagctggacttggcttgtcaaaacagctgacggcagcctagacattgttaacacaagc
aatgcgggtacacctttgacagatgctagccttactcctctacttaccgtagatttgtgg
gaacacgcttattacattgactaccgtaacgctcgtcctaagtaccttgaaggtttctgg
gcactagcaaactgggatttcgcagcgagcaacttcgcataa

DBGET integrated database retrieval system