KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3559
Entry
Glaag_3559        CDS       T01483                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Glaag_3559
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gag03400]
    Glaag_3559
Enzymes [BR:gag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Glaag_3559
DNA repair and recombination proteins [BR:gag03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Glaag_3559
 Prokaryotic type
     Glaag_3559
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-ProteinID: AEE24491
LinkDB
Position
complement(4192926..4193594)
AA seq 222 aa
MTQAATWQDVLGEEKRQAYFTDILHFIASERAQGKVIYPPDKDIFNAFANTELNQVKVVI
LGQDPYHGPEQAHGLSFSVQKGVKPPPSLKNMYKALQHDFPDFIVPDHGCLQSWALQGVF
LLNTVLTVEQGKAHSHAKIGWERFTDNVITQLNEHASGVVFLLWGSHAQKKAALIDASKH
HVLTAAHPSPLSAYRGFFECGHFAQTNQILKDSGRRPIDWQI
NT seq 669 nt   +upstreamnt  +downstreamnt
atgacccaagccgctacgtggcaagatgtactcggtgaagaaaagcggcaagcttacttc
accgatattttgcattttatcgccagcgaacgcgctcaaggtaaagtgatatacccgcct
gacaaagatatatttaacgcgtttgccaataccgagcttaaccaagtgaaagtggttatt
cttggtcaagacccataccacgggccagaacaggcccatggtttgagtttttcagtacaa
aaaggcgttaaaccgcctccttcgctaaaaaacatgtacaaagctctgcaacacgatttc
cctgactttatcgtacctgatcacggctgtttgcaatcttgggcgcttcaaggtgtgttc
ttacttaatactgtgctcactgttgagcaaggtaaggcgcattctcatgccaaaattggt
tgggaaaggtttactgataacgtgattactcagctcaatgagcatgccagtggtgttgta
tttttactgtggggcagccatgcacagaaaaaggcagcgttaattgatgcatctaaacat
catgtattaaccgcagcgcacccgtcgcctttgtcagcttatagagggttctttgagtgt
gggcatttcgcacaaaccaatcagatattaaaagacagcggtcgcaggccgatagactgg
caaatttaa

DBGET integrated database retrieval system