KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3855
Entry
Glaag_3855        CDS       T01483                                 

Definition
(GenBank) transcriptional regulator, AraC family
  KO
K13529  AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Glaag_3855
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gag03000]
    Glaag_3855
   03400 DNA repair and recombination proteins [BR:gag03400]
    Glaag_3855
Enzymes [BR:gag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     Glaag_3855
Transcription factors [BR:gag03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    Glaag_3855
DNA repair and recombination proteins [BR:gag03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Glaag_3855
SSDB
Motif
Pfam: AlkA_N Ada_Zn_binding HTH_18 HTH_AraC HhH-GPD HTH_24
Other DBs
NCBI-ProteinID: AEE24782
LinkDB
Position
4550739..4552112
AA seq 457 aa
MLTTQDFQQARLTRDPRFDGRFFIAVKSTGIFCRPICPAKLPREENVEYFTLAQQAMLAG
YRPCLRCRPDSAPHSHAWNGVDTTVNRALSLLSENLHLSMTSIAEKLGISDRYLRQLFIQ
HIGLSPKQYQVYEQILFAKQLLQHTQLPIEHVADAAGFNDARRLQYNMQRVMRRTPKELR
IKPSNDMQPIVIPLAYRPPYNWLHLRDFLARRAILGTESIEQNSYARNFTLGGSKGHFHA
LHQPDKNRFQVTLTLDDLTQLKPALNNIRRILDVDADSTTIDNQIQQSGLDPKLITPGIR
IPGIWDTFEAGCRAILGQQISVTAAINLVTKLVANLGETIPDGLSQEIGLTHYFPAPEAV
AHSDLSFLGMPNSRRETLRRFAAFYTQHPDAPPAEWLAIKGIGPWTIAYANLRGQSHADI
WLNSDLVIKKQLTLHAIDADKVSPWRSYLTFTLWSQA
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgctaacaacacaagattttcagcaagcaagattaacccgcgatccgcgatttgatggg
cgtttttttattgcggtcaaatctaccggcatcttttgccgtcctatttgcccagcaaag
ctaccacgtgaagaaaacgtagaatactttaccttggctcagcaagctatgctcgcaggt
taccgcccttgtttacgttgtcgtcccgacagcgccccgcattctcatgcgtggaacggt
gttgatacaacagtcaatcgagcactgtctttgctgagtgagaacctacatttaagcatg
acctcaattgccgaaaaactcggcattagcgaccgatatctacgccagctatttattcaa
cacatcggcctgagccccaagcaatatcaagtgtacgagcaaattctatttgccaaacaa
ttgctccagcatacccaactaccgatagaacatgttgccgatgccgcgggcttcaacgac
gccaggcgcttacaatacaatatgcaacgtgtaatgcgtcgcacacctaaggaattacgt
ataaaaccgagcaacgatatgcaacccattgtgatcccgctggcttatcgtccgccttat
aattggctgcatttacgcgacttcttggcacgccgagccattctcggaacagaatcgatt
gagcaaaacagctatgcccgcaactttaccttagggggcagcaaggggcactttcacgcg
ctacaccaacctgacaaaaatcgctttcaagtcacgttaacccttgatgatttaacgcag
ctcaagcctgcattaaacaatatacggcgaattttggacgtagacgcagacagcaccaca
atagataaccaaattcagcaaagtgggttagatcccaaacttatcaccccaggtattcgc
ataccgggaatttgggatacctttgaagcgggctgcagagccattctcggccaacagata
tcagtgactgcggcgattaatttggtgactaaattggttgccaacttaggagaaaccata
cctgatgggctttctcaagagattgggcttacgcattacttccccgcgcccgaagcggtt
gcacatagtgaccttagttttctcggtatgcccaatagtcgacgagaaactctgcgcagg
tttgctgcattttatactcagcatcctgatgcgccaccggctgagtggcttgccattaag
ggcattggcccatggactatcgcctatgcaaatcttcgagggcagtcacacgcagatata
tggctaaacagtgatttggtaattaaaaagcagttaacattacacgctattgacgcagac
aaggtaagcccttggcgcagttatttaacctttactctatggagccaagcataa

DBGET integrated database retrieval system