KEGG   Geoglobus ahangari: GAH_00737Help
Entry
GAH_00737         CDS       T03939                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
gah  Geoglobus ahangari
Pathway
gah00630  Glyoxylate and dicarboxylate metabolism
gah01100  Metabolic pathways
gah01120  Microbial metabolism in diverse environments
gah01200  Carbon metabolism
Module
gah_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:gah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GAH_00737
Enzymes [BR:gah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     GAH_00737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKG91928
UniProt: A0A0F7IFL3
LinkDB All DBs
Position
complement(628339..629673)
Genome map
AA seq 444 aa AA seqDB search
MSEQFGEIYDYYVDKGYQPNFKRDIVAVFRITPAEGYTIEECAGAVAAESSTGTWTTLYP
WYERERWEDLSAKAYEFSQSEDGSWIVKIAYPLHAFEEANLPALLASIAGNVFGMRRVAG
LRLEDLYFPEKLIREFGGPSKGIDGVRKMLEIKDRPIYGVVPKPKVGYSAEEFERLAYDL
LSSGADFVKDDENLASPWYNRFEERAETVSRIIERVESETGEKKTWFANITADVREMERR
LEILAELGLKHAMVDVVITGWGALEYIRDLAEDYGLAIHGHRAMHAAFTRNRSHGISMFV
LAKLYRLIGIDQLHVGTAGAGKLEGGKWEVVQNARILREKEYVPDEGDEIHLPQKFYGIK
PAFPTSSGGLHPGNLPLVFEALGTDIVVQLGGGTVGHPDGPAAGAKAVRQAIDAIMSGVP
LEEYAKSHRELARALEKWGTVTPI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcagtttggagagatttacgactactacgtggacaagggctaccagcccaac
ttcaagagggacatcgtggctgttttcaggataactcccgctgagggttacacaatcgag
gagtgtgccggggctgtagctgctgagagctcaacaggcacgtggacgacactctaccca
tggtacgagagggagaggtgggaggatctctcagccaaggcatacgagttctcccagagc
gaggatggttcctggattgtgaagatcgcctacccactccacgcgtttgaggaggctaac
ctgccggctctgctcgcgtcaatagccggaaacgtcttcgggatgaggagggtcgctggg
ctcaggctcgaggacctctacttcccggagaagctgataagggagttcggagggccgtca
aagggaatagacggagtaaggaagatgctcgaaataaaggacaggccgatctacggtgtc
gtgcccaaacccaaggttggatactcggccgaggagttcgagaggctcgcgtatgacttg
ctgtcgtctggagcggacttcgtcaaggacgatgagaatctggcgagcccgtggtacaat
cgctttgaggagagggctgagacggtcagcaggataatagagagggtcgagagcgagacg
ggcgagaagaagacctggtttgcgaacatcacggctgacgtgagagagatggagaggagg
ctcgagattctcgcggagctcgggctcaagcatgcgatggttgacgtcgtgataacggga
tggggagcactcgagtacataagggatctcgcagaggattacgggctcgcaattcacgga
cacagggcaatgcacgctgcgttcacgaggaacaggagccacgggatcagcatgttcgtc
ctcgccaagctctacagactcatagggatagaccagctccacgttggcacggcaggagca
ggaaagctggaaggcggaaagtgggaggtcgtgcagaacgcgaggattctgagggagaag
gagtacgtgccagatgagggagatgagatacacctgccccagaagttctacgggataaag
cccgctttcccgacgagctccggtggtctgcacccgggaaacctcccgctggtcttcgag
gccctcggaacggacatagtggtgcagctcggaggagggaccgtgggtcacccggatggc
ccggcagctggagccaaggctgtcaggcaggcgatagatgcaataatgtccggagttccg
cttgaagagtacgccaagtcccacagggagcttgcgagagccctcgagaagtggggaacc
gttacgcccatctga

DBGET integrated database retrieval system