KEGG   Geoglobus ahangari: GAH_01652Help
Entry
GAH_01652         CDS       T03939                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase, type 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gah  Geoglobus ahangari
Pathway
gah00620  Pyruvate metabolism
gah00680  Methane metabolism
gah00720  Carbon fixation pathways in prokaryotes
gah01100  Metabolic pathways
gah01120  Microbial metabolism in diverse environments
gah01200  Carbon metabolism
Module
gah_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GAH_01652
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GAH_01652
   00680 Methane metabolism
    GAH_01652
Enzymes [BR:gah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GAH_01652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKG91062
UniProt: A0A0F7IF51
LinkDB All DBs
Position
complement(1412447..1413871)
Genome map
AA seq 474 aa AA seqDB search
MRIPRVMSTQHPDNVEMPFFAKQSFFDGEDEIREAYYVFSHFGMEEQMWDFEGKEVDDFV
VKKLLTAYPNFFSEHVIGEDVRITPRVPNPEVERDEAKLLAETLEMIPRSHDYARKFYKD
PSPPIFEIIVPMVTKSEELERIYLFYRDFVAGKSKLVLADGTKVGEWLGEFEPETIGIIP
LFEDIPTMLRCDEIVREFADGRFEAIRVFLARSDPALNYGFIPATLAAKIALQRLYDLEI
DVYPIIGVGCPPFRGSFDPENMHALVEYPSVQTFTAQSAFKYDYDFRTVREAVEELRDSS
PERPQNVEVDEEIIQRLSDEYRKRVPRIAEFVNETSRFVPKRRMRKLHIGLFGYSRGDRV
KLPRAITFCAVLYSIGFPPELMGLSALTDKDYEELCEVIPTLEEQMRFVLSLFNPESLKI
VPFEEDVRRAMEFFDFESREDYREASSRTIDAIRRQNSISDAIIETGKLRRFLG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattccgagggtcatgagcacccagcacccggacaacgtggagatgccgttcttc
gcaaagcagtccttcttcgatggagaagacgagataagggaagcgtactacgtcttctcc
cacttcgggatggaggagcagatgtgggacttcgagggcaaggaggttgacgacttcgtg
gtcaaaaagctgctgaccgcatacccaaacttcttcagcgagcacgttatcggagaggac
gtgaggatcactccgagggttccaaaccccgaggttgagagggacgaagcaaagcttctg
gccgaaacacttgagatgattccgaggagccatgactatgcgaggaagttctacaaagat
ccctctcccccaatcttcgagataatagtcccgatggtcacaaagagcgaggagctggag
agaatatacctgttctacagagacttcgtcgcgggaaagtcaaagctcgtgctcgcagat
ggaacaaaagtgggagagtggctgggagagttcgagccggaaacaatcggaatcatccct
ctatttgaggacatcccgaccatgctgaggtgcgacgagatagtcagggaattcgcggat
gggaggttcgaggcgatcagggtttttctggcgaggtccgatccggcgttgaactacggc
ttcatacctgcaacgcttgcggccaaaatagcccttcagaggctctacgatctggaaatc
gacgtctacccgatcataggagttggctgtcctccgttcagggggtctttcgacccggag
aacatgcacgccctcgttgaatacccatctgtgcagacgtttacggcacaatctgcgttc
aagtacgactacgacttcagaaccgtcagggaagcggtcgaggagctcagggacagcagt
cctgagaggcctcagaacgtggaggtggatgaggagatcatacagaggctgagcgacgag
tacaggaagagagttccccggatagcggagttcgtcaatgagaccagcaggttcgttccg
aagaggaggatgaggaagctccacatcggcctcttcgggtattcgaggggagatagggtg
aagctcccgagggccataacgttctgcgcggtcctctactccataggctttccaccagag
ctcatgggcctatcggcactaacagacaaggactacgaagagctgtgtgaggtgattcct
accctcgaagagcagatgagattcgtcctgtccctcttcaaccctgaaagtctgaagata
gttccgtttgaggaggacgtgaggagggcaatggagttcttcgacttcgagagcagagag
gactacagggaggcgagcagcagaaccatagacgccatcagaaggcagaacagcataagc
gacgcgataatcgaaaccggaaagctcagaaggttcctcggctga

DBGET integrated database retrieval system