KEGG   Granulosicoccus antarcticus: IMCC3135_00275Help
Entry
IMCC3135_00275    CDS       T04938                                 

Gene name
ydhV
Definition
(GenBank) putative oxidoreductase YdhV
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
gai  Granulosicoccus antarcticus
Pathway
gai00030  Pentose phosphate pathway
gai01100  Metabolic pathways
gai01120  Microbial metabolism in diverse environments
gai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    IMCC3135_00275 (ydhV)
Enzymes [BR:gai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     IMCC3135_00275 (ydhV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASJ70181
UniProt: A0A2Z2NJD6
LinkDB All DBs
Position
72224..74080
Genome map
AA seq 618 aa AA seqDB search
MSWTRKILRINLSNGNIAEEPLNMEWANDYLGQRGLATRYLVDEIDPHCDALGPDNKLIM
TTGPLTGTTASTGGRYSVVCKSPLTGTVACSNSGGFFGAELKFAGWDMIIFEGKAASPVY
LHIENEAVKLMPADDLWGQSVWAADHLLRQKHLDPQIRIACVGRSAEQGCLYSAIVNDLH
RAAGRSGVGTVMASKNLKAVVVRGTNGISNISDPKRFMQTVRDGKKVLAENAVTGQGLPA
YGTQVLMNVINEVGALPTRNMREIQFEGASNVGGEAMHEPRKSDGKANLTTNGACYACTI
ACGRISTVDRTHFSVKDKPEYWINSGGLEYEAAWALGPDTGIDDIDALTYVNFLCNEDGM
DPISFGSTVAAAMEMFEDGNITTEHTGGMELKFGSAEALCWAAEVTAKGEGFGVDLGLGS
KRLCEKYGRPELSMTVKGQEFPAYDPRGIQGMGLAYATSNRGACHLRGYTVASEILGIPE
KTDPLESEGKAGLVKAFQDATAAVDSAGLCVFTTFAWTMDDIAPQVDAACEGDWSTERMM
EVGERIWNMERDFNQKAGITGADDTLPTRLLKEGGGTGPAKGRVSELDKMLPEYYQLRGY
SADGSMTEETRQKWSLPA
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgagttggacgagaaaaatacttcgcattaatctgagtaacggcaatatcgctgaagag
cctctcaatatggagtgggccaatgactatctgggacagcgaggcctggcgacacgttat
ctggtagatgaaatcgatccccattgtgatgcactgggaccagacaataagctgatcatg
accacaggcccgctgacgggcacgacagcctctacgggcggacgatattcggtggtctgc
aagagcccgctgacgggcacggtagcctgctccaactcgggtggcttttttggagccgag
ctgaaatttgcaggctgggacatgattatctttgaaggcaaggctgccagccccgtttat
ctgcatatcgaaaacgaagcagtgaagctgatgcctgctgacgatctatggggacaatct
gtctgggctgcagatcatctgctgcgtcagaagcacctggacccacaaattcgcattgcc
tgcgtcggtcgctcagccgaacaaggttgtctgtattccgccattgtcaacgatttgcac
cgtgccgcgggtcgttcaggcgtcggtacagtcatggcatccaagaatctcaaggctgtc
gtggttcgtggtaccaacggtatttccaatatcagtgatcccaagcggttcatgcaaacg
gtcagagacggcaagaaggtactggcagaaaacgcggtcaccggccagggtttgcctgcc
tacggtacgcaagtgctcatgaacgtgatcaatgaagtgggtgccctgccgacacgcaat
atgcgtgagattcagttcgaaggtgcctccaatgtcggcggtgaagcaatgcatgagcct
cgcaaatccgatggcaaagctaatctgacaaccaacggtgcctgctacgcctgcacgatt
gcctgtggacgaatctcgacagtggatcgtacgcacttctcggtcaaggacaaacctgaa
tactggatcaattctggtgggcttgaatacgaagccgcctgggcattgggacccgatacc
ggtatcgatgatatcgacgcgctgacctacgtcaatttcctgtgcaacgaagatggcatg
gatccgatctcatttggttctaccgtcgcggctgccatggagatgtttgaagatgggaac
attaccaccgagcataccggcggtatggagctgaagttcggatccgcagaggcgctctgt
tgggccgccgaagtgactgccaagggtgaaggattcggtgtggatctgggattgggttcc
aaacggttgtgtgagaaatacggccggccggagctatccatgaccgtcaaggggcaggaa
tttcctgcttatgaccctcgtggcattcagggtatgggtcttgcctacgccacctcaaac
aggggtgcttgccacctgcgtggatacacggttgcctcagagatcctgggtattccggag
aaaaccgatccgctggaatcagagggtaaagccggtctggtcaaggcctttcaggatgcc
actgcagctgtggactcggcgggactgtgtgtattcacaaccttcgcatggaccatggat
gacattgctccgcaagtggatgctgcctgtgaaggcgattggtctaccgaacggatgatg
gaagtgggtgaacgtatctggaatatggaaagagatttcaaccagaaggcgggtattacc
ggtgctgacgatacgctgccaactcgactgctcaaggaaggcggaggcacaggtccagcc
aaaggtcgagtcagcgagctggacaagatgctgcctgagtattatcagttacgtggctac
agtgcagatggctccatgactgaggaaactcgtcagaaatggtcgctacccgcatag

DBGET integrated database retrieval system