KEGG   Granulosicoccus antarcticus: IMCC3135_02860Help
Entry
IMCC3135_02860    CDS       T04938                                 

Gene name
gstA
Definition
(GenBank) Glutathione S-transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
gai  Granulosicoccus antarcticus
Pathway
gai00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:gai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IMCC3135_02860 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gai02000]
    IMCC3135_02860 (gstA)
Enzymes [BR:gai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     IMCC3135_02860 (gstA)
Transporters [BR:gai02000]
 Other Transporters
  Pores ion channels [TC:1]
   IMCC3135_02860 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: ASJ70685
UniProt: A0A2Z2NJK4
LinkDB All DBs
Position
641390..642049
Genome map
AA seq 219 aa AA seqDB search
MSTDNTITLFYSPQTRAAGIRVILEELGASYDLHVLNMKVDENHDPDFLAINPLGKVPTI
RHHGTVITEQVAIAIYLGDLFPDARLAPAIDDPQRGTYLRWLVYYAACFEPALMDKFTQN
EVTDTSQSVYGDFDTMLATLETALADGPWFLGERMSVADILWGIALNWTMTFKLIPERPV
FREYADRVTARAAFIKVAADDERLAAAHQAVVDQRRGEC
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacaatacaatcacgcttttctattccccacaaacgcgtgctgcaggtatc
cgtgtcattctcgaagaactcggcgcatcctacgatctgcatgtcttgaacatgaaggtt
gacgagaatcacgaccccgatttcctggcgatcaatccactgggcaaggtgcccacgatt
cgtcatcacggtacggtcataaccgaacaggtcgccatcgccatctatctgggagatctg
tttcccgatgccaggcttgcaccggcgattgacgatccgcagcgcggcacttatctgcgc
tggctggtgtattacgcggcctgcttcgagccagcactgatggacaagttcacacagaat
gaggtgaccgataccagtcagtcggtttatggagactttgacacgatgctggcaacactc
gaaacggcactcgccgacggcccgtggtttctgggagagcgcatgagcgtggccgatata
ttgtggggtattgcgctcaactggaccatgacgttcaagctgattcctgagcgccctgta
tttcgcgagtacgctgatcgtgtcactgcgcgtgcagcgtttatcaaggtagccgcggat
gacgaacgtctggcggccgcgcatcaggccgtggtcgatcagcgacgaggtgagtgttga

DBGET integrated database retrieval system