KEGG   Granulosicoccus antarcticus: IMCC3135_10335
Entry
IMCC3135_10335    CDS       T04938                                 

Gene name
rlmI
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase I
  KO
K06969  23S rRNA (cytosine1962-C5)-methyltransferase [EC:2.1.1.191]
Organism
gai  Granulosicoccus antarcticus
Brite
KEGG Orthology (KO) [BR:gai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gai03009]
    IMCC3135_10335 (rlmI)
Enzymes [BR:gai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.191  23S rRNA (cytosine1962-C5)-methyltransferase
     IMCC3135_10335 (rlmI)
Ribosome biogenesis [BR:gai03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    IMCC3135_10335 (rlmI)
SSDB
Motif
Pfam: Methyltrans_SAM PUA_3 Methyltransf_31 Cons_hypoth95 Methyltransf_25 Met_10 PrmA MTS Methyltransf_15 UPF0020 TRM Methyltransf_11 Methyltransf_24 Methyltransf_4 Methyltransf_10 Methyltransf_9 Methyltransf_12 Methyltransf_3 Methyltransf_23 Methyltransf_18
Other DBs
NCBI-ProteinID: ASJ72161
UniProt: A0A2Z2NQB4
LinkDB
Position
2335844..2337025
AA seq 393 aa
MTALRLKKREERRVLAGHGWIFSNEIDIEQTPLKGLDPGAAVTIESANGKFLAHAYVNPH
SLIAARVTSREAREPFNATVLRARLQQALSLREYLYPDPYYRLVYSEGDFLPGLVVDRYG
DVMVVQITTAGMERFRDDIVDALQSIAGATAIYLRNDASVRKLEHLPDYREWALGEPVEV
LQIRENNLLFEVPAELGQKTGWFYDHRDSRAALAPWVKERRVLDVYTYLGGFALNAAAAG
ASEVVGIDASQTAVDAATANAKLNGLQDKVEFRCDDAIEAMRSLFEAGERFDVVVLDPPA
FIKRRKDRDAGLRHYALNNRLAMRLLNPGGIIVSASCSQALSHEDLQQQMRLSMPKGSLG
LQVLAPLQQGADHPVNIAMPETLYLTGSIARLV
NT seq 1182 nt   +upstreamnt  +downstreamnt
gtgactgcactcagactcaaaaagcgtgaagaacgccgtgtcctggccggacatggttgg
attttttccaacgaaatagatatagaacagacaccgctcaagggtcttgacccaggcgct
gctgtcaccattgaatcggccaacggcaagttccttgcccacgcctatgtcaatccccat
tccctgattgctgcccgtgtaaccagtcgagaggcgcgtgaaccattcaacgccactgtt
ctgcgtgcccgcttgcaacaggctttgtccctgcgtgagtatctgtatccggatccctac
taccgattggtgtatagcgaaggtgacttcctgccgggtcttgtggtcgatcgctacggc
gatgtcatggtcgtgcagatcaccactgctggtatggagcgattccgcgacgatatcgtc
gatgcgctgcaatcaattgcgggcgctacggccatttatctgcgcaacgatgcctctgtg
cgcaaactcgaacacttgccagactaccgtgagtgggcgttgggtgaacctgttgaggtt
ctgcagattcgtgaaaacaatctgttgtttgaagtgcctgcagaactaggtcagaaaacc
ggctggttctatgatcatcgcgacagccgtgctgctctggctccctgggtgaaagagcgc
cgggtgctggacgtctacacctatcttggtggatttgccttgaacgctgctgcggctggt
gcctcagaagttgtgggtatcgatgcttcacagacagcggtcgatgcggctacggccaat
gcgaagcttaacggtttgcaggacaaggttgaattccgttgtgacgatgccatcgaagcc
atgcgcagcttgtttgaagcaggggagcggtttgatgttgttgtgctggatccgcccgcc
tttatcaagcgtcgcaaggacagagatgcaggcttgcgtcactatgcgctgaataatcgc
ctggcaatgagattgctcaatccaggtggaatcatcgttagtgcgtcctgttcgcaggcg
ctcagtcatgaagatttacagcagcagatgcgtctgagcatgcccaagggcagtctggga
ttgcaggtgctggcgccgttgcagcaaggtgcggatcacccggtgaatatcgccatgcct
gaaacactctatctgactggcagtatcgcccgactcgtttga

DBGET integrated database retrieval system