KEGG   Granulosicoccus antarcticus: IMCC3135_27030Help
Entry
IMCC3135_27030    CDS       T04938                                 

Gene name
rlmL
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase K/L
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
gai  Granulosicoccus antarcticus
Brite
KEGG Orthology (KO) [BR:gai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gai03009]
    IMCC3135_27030 (rlmL)
Enzymes [BR:gai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     IMCC3135_27030 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     IMCC3135_27030 (rlmL)
Ribosome biogenesis [BR:gai03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    IMCC3135_27030 (rlmL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 MTS
Motif
Other DBs
NCBI-ProteinID: ASJ75461
UniProt: A0A2Z2NZS6
LinkDB All DBs
Position
complement(6179033..6181408)
Genome map
AA seq 791 aa AA seqDB search
MSFFQPGSSVLLSSSTTPTLLDSLSHAELYATCGTGLEHLLAAELRELGLEHVQSAGAGV
RFSGGLAAGYTACLWSRVANRVLIPIHQGPAATPEALYALVQEIDWSEHVDVDGTLAVDF
FTANSAITHSQYGALKVKDAVVDQFRDAMGRRPNVERETPDLRINVYLFRDKARIAIDLS
GSSLHRRGYRDEGGLAPLKENLAAALLLSAGWPEALERGQALADPMCGSGTLLIEAAMMA
CNKAPGLLREYYGFLGWKGHDAELWQRTLDAAEAAIRPSPVIIAGSDQDPRAIDNCRHNL
AQAGLEDCVSLAVVALADGRPQTLGDISDGLLVTNPPYGERLAGDARFYAELGSSLSRQY
AGWQVALFTAEAAPYARARLPLSKQFKAKNGGIECVLLIGEIPRTGKARSHTAAPVELGY
DAPLAGGADAGSMEGGSTDVNNEGGFVGDDEHPQASLYRGPREVPGVDATPFANRLRKNL
RGLKGWRKQSDIRAFRLYDSDLPEFAVAVDLYQSDQLHCVVQEYQAPATVNVAMAEARLE
ALMAIIPETLDIAPNRVHLKVREVKSGLKQYEKLQPASSSVSLVEEFGARLEVNFTDYLD
TGLFLDHRPVRRHLFKNSEGKRFLNLFAYTGSATVASVMGGAASSVSVDTSNRYCQWAMR
NLDRNGAAQQLHEVVRQDVITWLEHASVGIRDDMLFDLILLDPPTFSNSNAVEDDWNVQR
DHVGAIDACLKVLAPGGTLIFSNNYRRFKMDPELLDDVTRGIKVEDRNSWSIDRDYQRNP
RIHQCWFIHKL
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttttcaaccgggttcatccgtcttgctgtcttcttccacaacacccactctg
cttgattccttatcccacgccgagctgtatgccacctgtggcaccggcctggagcatctg
ctggcggcagagctacgtgagctggggctggagcatgttcagagcgctggagccggggtg
cgtttcagtggcggtcttgccgctggctacaccgcctgtctgtggtcgcgagtcgccaac
cgcgttctgatccctatccatcagggccctgcagcgacacccgaggcgttgtatgcactg
gtgcaggagattgactggtctgagcatgttgatgtggatggcacgctggcagtggacttc
tttaccgccaactcagccattacgcattcgcaatacggcgcccttaaagtgaaggatgcg
gtggtcgatcagttccgtgatgccatggggcggcggccgaatgtcgagcgtgaaacgcct
gatttacgtattaacgtctatctgttccgtgacaaggcacgcattgcgatcgatttgtca
ggcagtagtctgcatcggcgcggttatcgtgatgagggcggattggcgcctctgaaggag
aatctggccgcagccctgctgttgtcggcgggttggccggaggccttggagcggggtcag
gcactggccgatccaatgtgtggttcaggcacattgctgatcgaggcggccatgatggcc
tgtaacaaggcgccgggactgttacgtgagtactatggatttctgggctggaaaggtcat
gatgccgagttgtggcagagaacactggatgccgccgaggctgccatcaggccctcgcct
gtgatcattgccggtagtgatcaggatccacgtgcgattgataactgtcgtcataacctg
gctcaggccgggctggaggactgcgttagtctggctgttgtggcgcttgccgacggtcgg
ccgcagactctgggcgatatcagtgacggtttactggtcaccaaccctccctacggcgaa
cggctggcgggtgatgcgcgtttttatgccgaactgggttccagtctgagcaggcagtat
gccggctggcaggtcgccttgttcacggcagaagcggcaccgtatgcacgtgcacgattg
cctctgtcaaagcagttcaaggcgaaaaacggcggaattgagtgtgtattactgatcggg
gaaatccccagaacaggcaaggcacgaagtcataccgccgccccggtagagctcggttac
gatgcgccgctggctggtggggccgatgctggcagtatggagggcggaagtacagatgtg
aacaatgagggtgggttcgtcggtgatgatgagcacccacaggcgtcgctgtatcgcggc
ccgcgagaagttccgggtgtggatgccaccccgtttgccaatcgtctgaggaaaaatttg
cgcggcctgaaaggctggcgcaaacaaagtgatattcgggcgttccggttatatgattcc
gatttgcctgaattcgcagtggctgtggatctgtaccaatccgatcagttgcactgtgtc
gtacaggaatatcaggcgccagccaccgtcaatgttgccatggcagaggcacgtctggag
gccttgatggccatcattcctgagaccctggatattgctcccaatcgagtgcatctgaaa
gtacgcgaggtaaagagcggcttgaagcagtatgagaagttacaacccgcctcttcgagt
gtttctctggttgaagagtttggtgcgcggctggaagtgaatttcacggattatctggac
accggcctgtttcttgatcaccggccggtgcgacgccacctgttcaagaatagtgaaggc
aagcgttttctcaatctgttcgcctatacgggcagtgctactgtcgcctctgtcatgggc
ggcgctgccagcagcgtctcggtcgacacctccaatcgttattgccaatgggccatgcgc
aatctggatcgcaacggtgccgcacagcaactacatgaagtggtacgacaggatgtcatc
acctggctggagcatgcctccgtcggcattcgtgatgacatgttgttcgatctgattctg
ctcgatcctcctaccttttccaactccaatgcggttgaggatgactggaatgtacagcgt
gatcacgtcggtgccatcgacgcatgcctgaaagtgctggcaccgggaggcaccctgatc
ttttccaataattaccggcgcttcaagatggaccccgaattacttgatgatgtaacacga
ggaatcaaggtggaggatcgcaatagctggtccattgaccgtgattaccagagaaacccg
cgcattcatcagtgctggttcatacataaactatag

DBGET integrated database retrieval system