KEGG   Gluconobacter albidus: A0U94_07810Help
Entry
A0U94_07810       CDS       T04736                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gal  Gluconobacter albidus
Pathway
gal00473  D-Alanine metabolism
gal00550  Peptidoglycan biosynthesis
gal01100  Metabolic pathways
gal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0U94_07810
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0U94_07810
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A0U94_07810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gal01011]
    A0U94_07810
Enzymes [BR:gal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A0U94_07810
Peptidoglycan biosynthesis and degradation proteins [BR:gal01011]
 Precursor biosynthesis
  Amino acid ligase
   A0U94_07810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AQS90892
UniProt: A0A1U9KYR0
LinkDB All DBs
Position
1741256..1742167
Genome map
AA seq 303 aa AA seqDB search
MKVAVLLGGTSSERPVSLVSGEAVIKALRDTGHDVTPIDVGPDIAATIASLKSTAPDVVF
NALHGPRGEDGAIQGVLEWLGLPYTHSGIRASAVAMDKGATRILLAAAGLPVAQGRVVTV
EELAEADPLPAPYVIKPVAEGSSVGVEIVRTGDNRRAEIAQTWRFGKDALVESFIPGREL
TASVMGDRALAVTDILPCETAAFYDFEAKYKAGGSRHVVPADIPQTVTDRALNYALRAHR
TLGCQGASRTDFRYNEDTDTLVILEVNTQPGMTPTSLLPEQAAYCGIPYPDLCDWMVREA
LTR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgcagtcctgctgggcggaacatccagcgagcgccccgtcagcctcgtcagt
ggcgaggccgtgatcaaggccctgcgcgacacgggtcacgacgtcacgccgatcgacgtc
ggcccggatattgccgcgacaatcgccagcctgaaatccacagcaccggacgtcgtcttc
aatgcgctgcacggcccgcgcggcgaggatggagccattcagggcgttctggaatggctc
ggcctgccttacacgcattccggaatccgggcctctgccgtcgcgatggacaaaggcgcc
acgcggatccttctggccgccgcaggtctgcccgtggcacaggggcgtgtggtcacggtc
gaggaactggccgaagccgatccccttcccgcaccctatgtcatcaaaccggtcgccgaa
gggtcatccgtgggggtcgaaatcgtgcggacgggcgacaatcgccgtgcggaaatcgcg
cagacatggcgcttcggaaaggacgcactggtcgaaagcttcatccccggccgcgaactg
accgccagcgtcatgggagaccgtgccctcgccgtcacggatatcctgccctgcgaaaca
gccgcgttctacgatttcgaagccaaatacaaggctggcggctcgcgtcatgtcgttcct
gcagatattccgcagaccgtgaccgatcgcgcgctcaactacgccctgcgcgcccatcgg
acgctgggctgtcaaggtgcgagccgtaccgatttccgttataacgaggataccgacacg
ctcgtcattctcgaggtcaacacacagccgggcatgacgcccacatccttgctgccggaa
caggctgcctattgcggcattccctatccggacctgtgtgactggatggtccgggaggca
ctgacgcgctga

DBGET integrated database retrieval system