KEGG   Gluconobacter albidus: A0U94_10790Help
Entry
A0U94_10790       CDS       T04736                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gal  Gluconobacter albidus
Brite
KEGG Orthology (KO) [BR:gal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A0U94_10790
Enzymes [BR:gal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A0U94_10790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin FAD_oxidored FAD_binding_2 Thi4 HI0933_like AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AQS91392
UniProt: A0A1U9L072
LinkDB All DBs
Position
complement(2386148..2387719)
Genome map
AA seq 523 aa AA seqDB search
MLQDDLKTQMRAYMEYLRDAVVLEATLGADARSAEVRGLLEDIASLSPKVTFSEKGQGPR
TPSFVIRRPDTDIQVCFAGLPMGHEFTSLVLALLQVSGHPPKIEADVVEQIRALDGDFHF
ETYFSQSCQNCPDVVQALNAMSVLNPKIHHTAIDGADFQDEVERLGIRSVPQVYLNGEPF
ASGRMEVADILAKLDTASVARSAEKLNDMAPFDVLVLGAGPAGDAAAIYSARKGLRTGLV
AERFGGQVMDTAGIENFISVQETEGPKLSAALEAHVRQYDVQIIASQLAAKLIPAEEVGG
LHQIVLESGATLRSKTVIIATGARWRHLGVPGEDEYRTKGVAYCPHCDGPFYKGRPVVVA
GGGNSGVEAAIDLAGIVSHVTLLQRGAHLKADKVLQDKLLSLSNVTVLTNALTTKIEGDG
KEVTGLTYSDGDGGLHQVKTDGVFIQIGLLPNSEWLKGALKLSPYGEIVINDHCATSVPG
VFAAGDVTTVPYKQIVIAMGEGAKASLSAFDYLIRLPVPAKEA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggacgacctgaaaacccagatgcgcgcctatatggagtacctgcgtgatgcg
gtcgtgcttgaggcgacccttggcgcggatgcccgctctgctgaagtgcgcggcctgctg
gaagacattgccagcctgtcccccaaggtgacgttttcggagaagggacagggtccccgc
acaccgtccttcgtgatccgccgtccggatacggatattcaggtctgctttgcgggcctg
ccgatggggcacgagtttacgtcgcttgttctggcgctgctgcaggtcagcggccatccg
ccgaagatcgaggcggatgtggtcgaacagatccgtgcgctggacggcgacttccacttc
gagacgtatttctcccagtcctgccagaactgtccggacgtggtgcaggcgctcaatgcg
atgagcgtgctgaacccgaagatccatcacaccgccattgatggtgcggattttcaggac
gaagtagagcgtctcggcatccgttcggtcccgcaggtttatctgaatggcgagcctttc
gcgtcggggcggatggaagtggcggatattctcgccaaactggacaccgcttctgttgcc
cggtcggcggaaaagctgaacgatatggcgccgtttgacgtgctggtacttggcgccggg
cctgcgggcgatgcggcggcgatctattctgcccgtaagggtctgcgcacgggtcttgtg
gcggagcggtttggtggtcaggtcatggacacggccgggatcgagaacttcatctccgtg
caggaaacggaagggccgaagctctcggccgcgcttgaagcccatgtgcggcagtatgat
gtgcagatcattgcgtcccagcttgcggcaaagctgatcccggctgaggaagtcggtggt
ctgcaccagatcgttctggaaagcggggccaccctgcgctcgaagacggtcatcattgcg
actggtgcgcgctggcggcatctgggtgtgccgggcgaggacgagtaccgcacgaagggc
gtggcctactgcccgcattgcgacggcccgttctacaaggggcgtccggttgtggtggct
ggtggcggcaatagcggcgtggaagcggcgatcgaccttgcggggatcgtgtcgcacgtc
accctgcttcagcgtggcgcgcatctgaaggcggacaaggtgcttcaggacaagctgctg
agcctgtcgaatgttacggtcctgaccaatgccctgaccacgaagatcgagggtgacggc
aaggaagtgaccggcctgacctatagcgacggcgatggcggcctgcatcaggtcaagacg
gatggcgtgttcattcagatcggcctgctgcccaattcggagtggctgaaaggcgcgctg
aaactgagcccttatggcgagatcgtcatcaacgatcactgtgccacatccgtccctggc
gtatttgccgcaggagacgtgacgaccgtgccttacaagcagatcgtcatcgcgatgggg
gagggggcgaaggcctctctgtcagcattcgattatctgatccgtctgccggttccggca
aaggaggcctga

DBGET integrated database retrieval system