KEGG   Gallibacterium anatis: UMN179_00068
Entry
UMN179_00068      CDS       T01482                                 

Definition
(GenBank) decarboxylase family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
gan  Gallibacterium anatis
Pathway
gan00230  Purine metabolism
gan00240  Pyrimidine metabolism
gan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UMN179_00068
   00240 Pyrimidine metabolism
    UMN179_00068
Enzymes [BR:gan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     UMN179_00068
    3.2.2.-  
     UMN179_00068
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4 DUF5339
Other DBs
NCBI-ProteinID: AEC16105
UniProt: F4HA73
LinkDB
Position
77981..79351
AA seq 456 aa
MSIYYINPRGSMDQLSHLEVARLKQGAEGDLYPLYRNCSLAVLNSGAITDDSRALLGKYP
DFAINLLTRERGIALELLNPPESAFVDDKIIRNIQYHLFAVLRDIIFAQINQDRFLGNHL
TQADISARITNQVFSILRNAKALRIGEDPNLVVCWGGHSINESEYQYCRAVGLELGYREL
NIVTGCGPGVMEAPMKGAAIGHANQRFKDSRFIGITEPSIIASEPPNPIVNELIIMPDIE
KRLEAFTRLGHTFLIFPGGPGTFEEFLFLLGIKLHPDNRNQTIPLILTGPSSCADYFATI
DRFVSKVLGEEARKQYEIIIDDPVAVARYAKQAMDNIKQQRFEKGDAYSFNWMLKIDPIL
QAPFEPDHQSMATLNLHLDQPLMNLVSNLRRAFSGIVAGNIKPNTKDEIAKYGVFKLHGD
TMVLENMENLLKDFIAQHRMKLPSADAYVPCYEIVK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgagcatttattacattaaccctcgtggcagtatggatcaactctctcatttggaagtt
gcccggttaaaacaaggcgctgaaggcgatctctatccactttatcgcaactgctcttta
gcagtattaaactccggtgcaataacagacgacagccgagctttacttggtaaatatccc
gattttgcgatcaacctattgacgcgtgaacgaggaatcgctttagaattactcaatcca
ccagaaagtgcatttgtcgatgataaaattattcgtaatattcaatatcatctatttgcg
gtgttacgcgatattatctttgcacaaatcaatcaagatcgctttctcggcaatcattta
acccaagccgatattagtgcacgtattaccaatcaagtgttttctatcctacgcaatgcc
aaagcgctgcgtatcggtgaagatccgaatctggttgtgtgctggggcggacactccatt
aatgaaagcgaataccaatattgccgtgccgttggcttggaattgggctatcgggaatta
aatattgtgaccggttgcggcccgggtgtaatggaagcgccgatgaaaggtgccgctatc
ggacacgcaaatcaacgttttaaagacagccgttttattggtattaccgaaccttcaatt
atcgcttccgagccgccaaacccgattgtaaatgagctaatcattatgccggatattgaa
aaacgtctggaagcctttactcgattaggacacacttttcttatttttcccggcggtccg
ggtacatttgaagagtttttattcttgctcggtattaaactgcatcctgacaatcgcaac
caaacgatcccactgattttaaccgggccatcttcttgcgccgattattttgccacgatt
gaccgttttgtcagcaaagtattgggtgaagaggcacgtaaacagtatgaaattatcatt
gatgatccggttgcagtcgcacgttatgcaaaacaggcaatggataacattaaacaacaa
cgttttgaaaaaggtgatgcttacagttttaattggatgctaaaaattgatccgatacta
caagcaccgtttgaaccggatcaccaatcaatggcaacgcttaatcttcatttagatcag
ccattaatgaatttagtttctaatctaagacgggctttttccggtattgttgccggtaat
attaagccaaacaccaaagatgaaattgcgaagtatggtgtctttaaactgcacggcgat
acgatggtattggaaaatatggagaatctgttaaaagattttattgctcagcatcgtatg
aaattaccaagtgcggatgcctatgtaccttgctatgaaattgtaaaatag

DBGET integrated database retrieval system