KEGG   Gallibacterium anatis: UMN179_00482Help
Entry
UMN179_00482      CDS       T01482                                 

Definition
(GenBank) putative dehydrogenase
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
gan  Gallibacterium anatis
Pathway
gan00053  Ascorbate and aldarate metabolism
gan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    UMN179_00482
Enzymes [BR:gan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     UMN179_00482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C FAD_binding_3 HI0933_like Pyr_redox_2 Sacchrp_dh_NADP XdhC_C Pyr_redox_3 Thi4 FAD_binding_2 adh_short GIDA NAD_binding_8 NAD_binding_7 Pyr_redox UDPG_MGDP_dh_N DAO NADH_4Fe-4S FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AEC16518
UniProt: F4HCH1
LinkDB All DBs
Position
495982..496986
Genome map
AA seq 334 aa AA seqDB search
MKALVCNKPFEFSYKQLSTPTIEEDQVLLKVAAVGICGTDIHAFGGNQPFFSYPRILGHE
ASGIIADIGSKVSQWKVGQRVALIPYVSCGECDACRNGRTNCCEKISVIGVHEDGAFSEY
LAAPARNILAIDDQVDDITAALIEPFAISAHAVRRAEIKAGDDVLIVGAGPIGLGAAAIA
AADGANVAIADTSAERREHIKTQLKLPAFNPIDEKVENFFNGKLPLIVIDATGNQKAMNN
DVNLIRHGGRIVFVGLFKGDFSIHDPDFHKKETTLLGSRNATPEDFEKVQSLMAQGKLSA
AMMLTHTFKFDQLAEVFEEQVVNNKDLIKSVVTY
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttagtttgcaataaaccttttgaattttcatataaacaactctcaactcct
acaatcgaagaagatcaagtcttgcttaaagttgctgctgttggtatttgcggaacagat
attcacgcatttggaggaaatcaacctttctttagctaccctcgtattttaggacacgaa
gctagtggcatcattgctgacattggttcaaaagtatctcaatggaaagttggtcaaaga
gttgcactgattccttatgtttcttgtggtgagtgtgatgcttgccgaaacggacgcaca
aactgctgtgaaaaaatttctgttattggtgttcacgaagatggcgcatttagcgaatat
cttgctgcccctgctagaaatatcctagctatagatgatcaagttgatgatatcactgct
gcattaatagaaccttttgcaatcagtgctcacgcagttcgccgagcagaaattaaagcc
ggagatgatgttttaatcgttggtgccggtcctattggtcttggtgctgctgcaatcgca
gctgctgatggggcaaatgtcgctattgctgataccagtgctgaaagaagagaacatatt
aaaacacagcttaaacttccagcctttaatccaattgatgaaaaagtagaaaacttcttt
aatgggaaattacctcttattgtcattgatgccactggtaatcaaaaggcaatgaataat
gatgtaaatctcatccgccacggtggcagaattgtttttgtcggtttatttaaaggagat
ttctccatccacgatcctgatttccataaaaaagaaactacccttttaggaagccgtaat
gcaactccagaagattttgaaaaagtacaatcccttatggcacaaggaaaattaagtgct
gcaatgatgctaactcatacttttaaatttgatcaacttgcagaagtttttgaagagcaa
gtagtaaataataaagatttaataaaaagtgttgttacttattaa

DBGET integrated database retrieval system