KEGG   Gallibacterium anatis: UMN179_00756
Entry
UMN179_00756      CDS       T01482                                 

Definition
(GenBank) mannose-specific PTS system protein IID
  KO
K02796  mannose PTS system EIID component
Organism
gan  Gallibacterium anatis
Pathway
gan00051  Fructose and mannose metabolism
gan00520  Amino sugar and nucleotide sugar metabolism
gan01100  Metabolic pathways
gan02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:gan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    UMN179_00756
   00520 Amino sugar and nucleotide sugar metabolism
    UMN179_00756
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    UMN179_00756
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gan02000]
    UMN179_00756
Transporters [BR:gan02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component
    UMN179_00756
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AEC16787
UniProt: F4HE57
LinkDB
Position
complement(810755..811606)
AA seq 283 aa
MGEAEMTTETKKVTQSDLNKVVLRSNLFQGSWNFERMQALGFAFSMVPVIKRLYPDPNSQ
ERKDAIKRHLEFFNTQPFVAAPVLGVTIAMEEERANGKPIEDSAINGIKVGLMGPLAGVG
DPIYWGTARPVFAALGAGLALSGSILGPLLFFVLFNLVRLATRYYGVTYGYKKGLDVVKD
MSGGLLQKLTEGASILGLFIMGALVQKWTTINVPLVVSTIEKQDGTIEITTVQSILDSLM
PGLLPLLFTFACMWLLRNRVNALWIIIGIFIIGIIGAATGILG
NT seq 852 nt   +upstreamnt  +downstreamnt
atgggggaagcagagatgacaacagaaactaaaaaagtaacccaaagcgatttaaataaa
gtcgtactccgctcaaatcttttccaaggatcttggaactttgagcgtatgcaagcgtta
ggttttgccttttcaatggtgccggtgattaaacgtttatatcctgatccgaattctcaa
gagcgtaaagatgcgattaaacgtcatttggaattcttcaatacacaacctttcgtagca
gcaccggtattaggtgtaactattgcgatggaagaagaacgtgctaatggtaagccgatt
gaagattcagcaatcaacgggattaaggttggtttaatggggccattggcaggtgtgggt
gatccgatttattggggaactgcacgtccggtatttgccgcattaggggcaggtttggca
ttaagcggtagtattttagggccattgcttttcttcgtattatttaaccttgtgcgttta
gcaacacgttactatggtgtaacttacggctataaaaaaggtttggatgtggttaaagat
atgagcggcggtttattgcaaaaattaaccgaaggggcttctatcctaggtctgtttatt
atgggagcgttggtgcagaaatggacaactattaatgtgccactcgtagtttctactatt
gaaaaacaagatggaactattgaaattaccactgttcagtcaatcctcgacagcttaatg
ccgggattattaccgttgctgtttacctttgcctgtatgtggctattgcgtaaccgtgtc
aatgcactttggatcattatcggtattttcattatcggtattatcggggcggcaaccgga
attttaggctaa

DBGET integrated database retrieval system