KEGG   Gallibacterium anatis: UMN179_01201
Entry
UMN179_01201      CDS       T01482                                 

Definition
(GenBank) F0F1 ATP synthase subunit C
  KO
K02110  F-type H+-transporting ATPase subunit c
Organism
gan  Gallibacterium anatis
Pathway
gan00190  Oxidative phosphorylation
gan01100  Metabolic pathways
Module
gan_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:gan00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UMN179_01201
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:gan00194]
    UMN179_01201
Photosynthesis proteins [BR:gan00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   UMN179_01201
SSDB
Motif
Pfam: ATP-synt_C EpuA
Other DBs
NCBI-ProteinID: AEC17224
UniProt: F4H9R6
LinkDB
Position
complement(1302108..1302362)
AA seq 84 aa
METVISATIIAASIMFAFAALGTAIGFGILGGKYLESAARQPELANSLLTKMFIVAGLLD
AIAMIAVGIGLYFAFANPFVSLLG
NT seq 255 nt   +upstreamnt  +downstreamnt
atggaaactgtaattagtgcaacaattatcgctgcatctatcatgttcgcttttgctgct
ttaggtaccgctattggtttcggtatcttaggtggtaaatacttggaatcagctgctcgt
caaccagagttagcaaactctttattgacaaaaatgtttatcgttgctggtttgcttgat
gcgattgcgatgattgcagtaggtatcggtttatactttgcgtttgcaaacccattcgtt
tcattgttaggttaa

DBGET integrated database retrieval system