KEGG   Gallibacterium anatis: UMN179_p00003
Entry
UMN179_p00003     CDS       T01482                                 

Gene name
traG
Definition
(GenBank) putative conjugal transfer pilus assembly protein TraG
Organism
gan  Gallibacterium anatis
SSDB
Motif
Pfam: TraG_N DUF29 DUF2070
Other DBs
NCBI-ProteinID: AEC18537
UniProt: F4HFX0
LinkDB
Position
pUMN179:complement(2193..3752)
AA seq 519 aa
MDGIPIYTNSYFEYYLTVLGWFINNGIWDLLVETGLFSTPFFAHLIRFWLKVREEGDDEG
NKGKLLLNRIEHAFYLSMVVILFTCMPLFTINVNNITYDETRSKQCKVSIISPQQSSMSY
MQTTLDGQQAKMPLWWAFTTVVSKAVTQAAITTIPCSPDIRQLRFEVNNTLITSAVLRQE
VQDFFEQCYVPARKKIKRKNVKTNEVQDRDLDWIGSRLMVETPNLYDSYRAKMPRPEFPY
DPKRDQALPNTGKGGFPKCNEWWDKPGVGLKARLLEQYSPSTIASFKQTYDLDKNYYNAN
PKRISDSEMADVLVRNLVKPEKMAVSNGKIYSNLSSDIISDFFSGLRSGLSKLVAGAGTT
TTLAVVTPGFDAMRQALPMIQGLLSVVFVISIPFVMVFSGYSMKAAMVMTFIQFGLYFLT
FWWELARWLDSSLLSGLYGSDTHSYFNLYGLENTEDDTVVKLVIGAMYIVFPGFFMMAMG
KAGVAVGEVAGYLGSAAQKTKKGGESAADSIKNRIKNNM
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacggtattcctatttatactaatagttattttgaatattacctgaccgtgttgggt
tggttcatcaacaatggcatatgggatcttcttgtcgaaacaggtttgttttctacgcca
ttctttgcgcatttaataagattttggctaaaagtgcgtgaagagggggacgatgaaggc
aataaaggcaaattattgctaaatcgcattgaacacgctttttatttgagtatggttgtt
attttatttacctgtatgccactattcacgattaatgtgaacaacatcacttatgatgaa
actcgctctaaacagtgcaaagtcagcattatctcgcctcaacaaagctcaatgagctat
atgcagacaacgttagacgggcaacaggcaaaaatgccactttggtgggcgtttacgact
gttgtaagtaaagccgtaacacaagcagctattacgacaatcccttgcagtcctgacatt
agacaactgcgatttgaagttaataacacgcttattactagtgcagttttgcgacaagaa
gtgcaagacttttttgagcaatgttatgttccagctcgcaaaaaaattaaacgcaaaaac
gttaaaaccaatgaggttcaagatagagatcttgactggattggttcacgcttaatggtc
gaaacaccaaatttatatgattcctatcgagctaaaatgccacgtccggaattcccttat
gatccgaagcgtgatcaggcgttgccgaataccggcaaaggcggattcccgaaatgcaat
gaatggtgggataaaccaggcgtaggattaaaagcgagattgttagagcagtatagccca
agcactattgctagttttaaacagacttatgatttagataaaaactactacaatgccaat
ccaaaacggatttcagattctgaaatggcagatgttttagtccggaatttagtgaagcca
gaaaaaatggcagtatctaatgggaaaatctattctaacttaagtagtgacattatttct
gattttttttcagggcttcgatcagggctatctaaactggttgccggagcaggtacaaca
acaacgcttgcagtggtaacacccggttttgacgcaatgcggcaagcgttgccaatgatt
caaggattgctatccgttgtgtttgtaatttccattccgtttgtaatggtgtttagtggt
tacagtatgaaagcggcaatggtgatgacttttattcagtttggactgtatttcttaaca
ttctggtgggagctcgcgagatggcttgacagctcgttacttagtggactttatggcagc
gatacacacagttattttaatctctatggattagaaaacacggaagatgacacggtagtt
aaactggtcattggggcgatgtatatcgtttttccgggcttctttatgatggcaatgggg
aaagctggggtggcagttggagaggttgcaggatatttaggttcagcagcgcaaaaaact
aaaaaaggaggtgaatcagcagccgattctattaagaatagaataaaaaacaatatgtga

DBGET integrated database retrieval system