KEGG   Geobacter anodireducens: A2G06_03895Help
Entry
A2G06_03895       CDS       T04399                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gao  Geobacter anodireducens
Pathway
gao00564  Glycerophospholipid metabolism
gao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A2G06_03895
Enzymes [BR:gao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A2G06_03895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 GIDA Pyr_redox_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ANA39649
LinkDB All DBs
Position
824592..826145
Genome map
AA seq 517 aa AA seqDB search
MKREDLLRYLTETEVWDMIVIGGGATGLGTAVEAAGRGYRTLLLEQGDFAQGTSSRSTKL
IHGGVRYLQQGNLSLVLEALRERGLLIRNAPHLVHNLSFVVPLYDWWEGPFYGIGLKLYD
VLAGTLGLGPSRLLSREETLDHIPTVEPRGLRGGVIYHDGQFDDARLAISLALTLADLGG
VALNHFPVTGIISHDGLVAGVEARDRETGRAFRIMGRAVINAAGPFVDGVRRLADPAARD
LIAPSQGVHLVLDGSFLPGDSAIMVPHTDDGRVLFAVPWHGRTVVGTTDTPIPAAGLEPR
PLPEEIDFLLSHAARYLTRHPERRDVLSTFAGIRPLVRSDGGGTTASLSRDHTLLVEGSG
LVTIAGGKWTTYRKMGEDTVTAAAQVAGLDHRPSVTETLRIHGWQEGTADGPLQVYGCDA
AALEQLLAENSAWREPLHPALPYRAGEVVWGVRHEWARTVEDVLARRTRALLLDARAAVA
AAPRVAELMARELGRDSAWQAAQVAAFTTLAGGYLPE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgaggatctgctgcgatacctgaccgagaccgaggtctgggacatgatcgtg
atcggcgggggcgccacgggcctcggcacggcggtggaggcggccggccgcggctaccgg
acccttcttctggagcagggggattttgcccaggggacctccagccggagcaccaagctg
atccacggcggggttcgctacctgcagcaggggaacctttcgctggtgctggaggcactg
cgggagcggggtctgctcatccgcaacgccccgcatctggtgcacaacctctcctttgtg
gtgccgctctacgactggtgggaggggcccttctacgggatcgggctcaagctgtacgac
gtcctggccggcacgctggggctggggccgtcccgcctgctgtcccgggaagagaccctg
gatcacatccccaccgtggagccccgtggcctgcgcggcggggtgatttaccacgacggc
cagttcgacgacgcgcgcctcgcgatcagcctggccctgaccctggccgacctgggcggg
gtggcgctcaatcacttcccggtgaccggcatcatcagccatgacggtctcgtggccggg
gtggaggcgcgggaccgggagaccggccgcgccttcaggatcatggggcgggcggtgatc
aatgccgccggtccgttcgtggacggggtgcggcggcttgccgacccggcggcccgggac
ctcattgccccgagccagggggtgcacctggtgctggacggctcgttcctgcccggcgac
agcgcgatcatggttccccacaccgatgacgggcgcgtcctgttcgcggtcccctggcac
ggccggaccgtggtgggcaccaccgatacacccatcccggcggccgggctggagccgcgc
cccctgccggaagagatcgactttctcctgtcccatgcggcccgctacctgacccgccat
cccgagcgtcgggacgtgctgagcaccttcgccggcatccggcccctggtccgtagcgac
ggcggcggcaccaccgcctccctttcccgggaccacaccctgctggtggagggaagcggc
ctggtcaccattgccggcggcaagtggaccacctaccggaagatgggggaggacacggtt
accgccgctgcccaggtggccggcctggatcatcggccgtcggtcacggagacgctgcgg
attcatggctggcaggagggtacggcggacgggccgttgcaggtctacggctgcgatgcc
gcagccctggagcaactcctggctgaaaactccgcctggcgtgagcccctgcatccggcg
ctcccctaccgagccggggaggtcgtctggggggtgcgccacgagtgggcccgcacggtg
gaggatgtcctggcccgccgcaccagggcgctgctgctggatgcccgcgccgccgtggcc
gcggccccgcgggtggcggagctgatggcccgcgagctggggcgggacagcgcctggcag
gcggcgcaggttgccgcgttcaccacgttggccgggggctacctgccggagtga

DBGET integrated database retrieval system