KEGG   Geobacter anodireducens: A2G06_06010Help
Entry
A2G06_06010       CDS       T04399                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
gao  Geobacter anodireducens
Pathway
gao00061  Fatty acid biosynthesis
gao00780  Biotin metabolism
gao01100  Metabolic pathways
gao01212  Fatty acid metabolism
Module
gao_M00083  Fatty acid biosynthesis, elongation
gao_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:gao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A2G06_06010
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A2G06_06010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gao01004]
    A2G06_06010
Enzymes [BR:gao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A2G06_06010
Lipid biosynthesis proteins [BR:gao01004]
 Fatty acid synthase
  Component type
   A2G06_06010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: ANA39950
LinkDB All DBs
Position
1323317..1323769
Genome map
AA seq 150 aa AA seqDB search
METVFDINEIMKILPHRYPFLLVDRIVEYVAGERIVGIKNVSINEPFFQGHFPGHPVMPG
VLIVEAMAQVGGIYAYVTLGDEVRDKVCYFASIDNVKFRKPVVPGDQLRIEVTISGCKRG
IWCFSARATVNGKLVTEAELKATFADKEKL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagtctttgatatcaacgaaatcatgaagattctcccccaccgctaccccttc
ctcctggtggatcggatcgtggagtacgttgccggcgagcggatcgtggggatcaagaac
gtcagcatcaacgagccgtttttccaaggccactttcctggacatccggtgatgccggga
gtcctgatcgttgaggccatggcccaggtggggggaatctacgcctatgtgaccttgggt
gacgaggttcgcgacaaggtctgctacttcgcctccatcgacaacgtcaagttccgcaag
ccggtggtgccgggagaccaactgcggatcgaagtgacgatctccggttgcaagcggggt
atctggtgcttcagtgccagggccaccgtgaacggcaagctggtcaccgaggcggagctc
aaggcgacctttgccgacaaggaaaagctctaa

DBGET integrated database retrieval system