KEGG   Geobacter anodireducens: A2G06_08500Help
Entry
A2G06_08500       CDS       T04399                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
gao  Geobacter anodireducens
Pathway
gao00250  Alanine, aspartate and glutamate metabolism
gao00410  beta-Alanine metabolism
gao00430  Taurine and hypotaurine metabolism
gao00650  Butanoate metabolism
gao01100  Metabolic pathways
gao01110  Biosynthesis of secondary metabolites
gao01120  Microbial metabolism in diverse environments
gao02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A2G06_08500
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A2G06_08500
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A2G06_08500
   00430 Taurine and hypotaurine metabolism
    A2G06_08500
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A2G06_08500
Enzymes [BR:gao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A2G06_08500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ANA40329
LinkDB All DBs
Position
complement(1868068..1869726)
Genome map
AA seq 552 aa AA seqDB search
MPKNRDAARASLENLYRIFTVPEAPDSTLGAIDQAISGDVTGFLQTHIVAIERDLEDIEA
NFSSFAIPEEPTYVSEYTEFVKENLVAHSVHTASPAFVGHMTSALPYFMLPLARLMTALN
QNVVKVETSKAFTPMERQVLAMLHHLVYRRDEDFYPSWIHNSRHALGAFCSGGTIANITA
LWVARNRLFAPNGAFRGIAREGLARALKHRGADGIAVLVSERGHYSLGKAADLLGIGRDD
LVKVKTEANNRIDLKALREECRRLQDRNTLPLALVGIAGTTETGNVDPLEAMADLAQELG
CHFHVDAAWGGPTLFSDRHRSLLKGIERADSVTIDGHKQLYVPMGAGMVVFKDPTALSAI
EHHANYILRHGSKDLGSHTLEGSRPGKAMLVHAGFSIIGRKGYELLIDMGIERARTFADM
IRQHPDFELISEPELNILTYRYCPAAVQQTLHDVTDRERADINALLDQVCQLLQKFQREA
GKTFVSRTRLHVAHHDRELTVLRVVLANPLTTNEILESVLAEQCELVQLPEIQAVLQQVE
ELCTGLAKAASW
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaaatcgtgacgcagctcgtgccagccttgagaacctctaccggatcttcacc
gtgcctgaagcacccgattcgaccctcggtgccatcgatcaggccatatccggcgatgtc
accggcttcctgcagacccatatcgttgccatcgagcgcgatctggaagatatcgaagcg
aatttttcctccttcgccattccggaagaacctacctacgtttccgaatacaccgaattc
gtcaaagagaacctcgtcgcccactcggttcataccgcctcgccggcgttcgtcgggcac
atgacctcggcgctcccgtacttcatgctgccgctggcgcgtcttatgaccgccctcaac
cagaacgtggtcaaggtggagacatccaaggcctttacgccgatggaacggcaggtcctc
gccatgctccatcatctggtgtatcgccgcgacgaagacttctacccatcatggattcat
aacagccggcatgccctgggtgccttctgctccggcggtaccatcgccaatatcacggcc
ctgtgggtggcacgcaaccgtctgtttgccccgaacggagcatttcgcggcattgcccgg
gaggggctggcccgtgcgctcaagcatcgcggcgcggacggcattgccgtgctcgtctcc
gaacgggggcactactccctgggaaaggcggccgacctgctcggcatcggccgggacgat
ctggtcaaggtgaaaaccgaagcgaacaaccgcatcgacctcaaggcactgagagaagag
tgccggcgcctccaagaccggaacacgctcccgctggcgctggtcggcatcgccggaacc
accgaaaccggcaacgtggaccctctggaggcgatggccgatcttgcccaggaacttggc
tgtcatttccatgtggacgccgcctggggtggaccgacccttttttccgatcgccaccgc
tccctgctcaagggtatcgagcgggccgactcggtcaccattgacgggcacaagcagctc
tatgtgcccatgggggcgggaatggtcgtcttcaaggatcccaccgccctgtcagccatc
gagcatcacgccaactacatcctgcgccacggttccaaggatctgggcagccataccctg
gagggatcacggccggggaaggcgatgctggtacatgccggtttctcgatcattggacgc
aaagggtacgaactgctgatcgacatggggatcgaacgtgctcgcacctttgccgacatg
atcaggcagcatcccgatttcgaactgatcagcgaaccggaactgaatatcctcacgtac
cgctactgcccggccgccgttcagcagaccttgcacgacgtgacggaccgggaacgcgcc
gatatcaatgcgctcctcgatcaggtctgccagttgctgcagaaattccagcgcgaagcc
gggaaaacctttgtctcccggacacggctgcatgtggcgcaccatgaccgggaactcacc
gtgttgcgcgtcgtcctggccaacccgctgacaaccaacgagattctggagtccgtactg
gcggagcagtgtgaactcgtgcaattgccggagattcaggcagtgctgcagcaggtggaa
gagctctgtaccggtctggcaaaagccgcctcatggtag

DBGET integrated database retrieval system