KEGG   Geobacter anodireducens: A2G06_16175Help
Entry
A2G06_16175       CDS       T04399                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
gao  Geobacter anodireducens
Pathway
gao00030  Pentose phosphate pathway
gao01100  Metabolic pathways
gao01110  Biosynthesis of secondary metabolites
gao01120  Microbial metabolism in diverse environments
gao01130  Biosynthesis of antibiotics
gao01200  Carbon metabolism
gao01230  Biosynthesis of amino acids
Module
gao_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:gao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A2G06_16175
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    A2G06_16175
Enzymes [BR:gao01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     A2G06_16175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C DXP_synthase_N SPDY
Motif
Other DBs
NCBI-ProteinID: ANA41511
LinkDB All DBs
Position
complement(3513846..3515852)
Genome map
AA seq 668 aa AA seqDB search
MAAVSLTNEDARLGADTLRMLAVDAVEAAASGHPGLPMGAADYAFLLWHSHLRFDPADPE
WPGRDRFILSAGHGSMLLYGLLHLFGFDLPLDELKRFRQWGSRTPGHPEYGHTPGVEVTT
GPLGQGFAMGVGMALAARMGAARFADERFDPCAHHIYALVSDGDLMEGISQEAASLAGHL
RLGNLVYLYDDNRITIEGSTDLAFSEDTAGRFAALGWHVQAVDGHDVRQVDEALWRARVE
RERPSLIIARTHIAQGSPGKHDSAAAHGSPLGAEEAAATRRSLGWPDELFHVPERIREIC
EQRREALAEARAAWQDELRRWRRRNSDKGRLWDLMAEKGVPRDLEARLLAAVGAEAGATR
ALAGKALQAAAAAVPSLAGGSADLEPSTNTRIKDSSSVLPGSYGGRNLHFGVREHAMAAI
MNGMARHGGFIPYGATFLVFADYCRPAIRLAALMKQQAVYVFTHDSLFVGEDGPTHQPVE
QLSSLRLIPNLRVIRPADGPETALAWAAALRRTDGPTALVLTRQKVPAIAREESLDPRTF
AKGGYVVRSGGAAPAVVLMASGSEVGLALAAAEIMAGNGVAARVVSIPCLEAFLAQPEGY
RRRCLPGRVPRVAVEAGHGGLWWRLLGPAGLFIGLESFGASAPEKVLAEQYGFTPELVAR
RVAEFVER
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggtaagccttaccaacgaagacgcccgcctgggcgccgataccctcaggatg
ctggcggtggacgcggttgaagccgctgcctccggtcacccggggctgcccatgggggcc
gccgactacgcctttctcctctggcactcccacctccgcttcgaccccgccgacccggag
tggccggggagggaccggttcatcctctcggcgggacacggctccatgctcctctacggc
ctgctccacctcttcggcttcgaccttcccctggatgagctgaagcggtttcgccagtgg
gggagccgcaccccgggccatcccgaatacggccacacccccggcgtggaggtgaccacc
ggccccctggggcaggggttcgccatgggggtgggcatggccttggcggcgcgcatgggg
gccgcccgcttcgccgacgagcgattcgatccctgcgcccaccatatctacgccctggtg
agcgacggcgacctcatggagggaatcagccaggaggcggcatccctggccgggcacctg
aggctcggcaacctggtctacctgtacgacgacaaccgaatcaccatcgagggctccacg
gacttggccttttccgaggacacggcggggcgtttcgcggctcttggctggcacgtgcag
gccgttgacggccacgatgtccgccaggtggacgaggccctctggcgggcccgggtggaa
cgggagcggccctctctcatcatcgcccggacccatatcgcccagggctcgcccggcaag
cacgactctgccgccgcccacggctcgcccctgggtgccgaggaggccgccgccacgcgc
aggagcctggggtggcccgatgagttgtttcacgtgccggagcggattcgggagatctgc
gaacagaggcgggaagcgctcgccgaggcgcgcgccgcctggcaggatgagctccgccgc
tggcgccgccgcaattccgataagggacggctctgggatctgatggcggaaaagggggtg
cccagggatctggaggcccggctgctggcggcggtgggagccgaagccggcgccacgcgc
gcccttgcgggcaaggccctccaggcggccgccgccgcggtgccctccctggccgggggc
tcggcggacctcgagccctccaccaacacccggatcaaggattcctcctccgtgctcccc
ggcagctacggggggcgcaatcttcacttcggcgtgcgcgagcatgccatggccgccatc
atgaacggcatggcccgccacggcgggttcatcccctacggcgcaaccttcctggtcttt
gccgattactgccggccggccatccggctggcggcgctcatgaagcagcaggcggtgtac
gtgttcacccacgattccctcttcgtgggtgaggacggtcccacccaccagcccgtggag
cagctctcgtccctgcggctcatccctaacctccgggtgatccggccggcggacggtccc
gaaacggctctggcctgggccgcggccctgcggcgcacggacggccccacggcccttgtc
ctgacccgccagaaagtgccggccatcgcccgggaggagtccctggaccccagaaccttt
gccaaggggggctacgtggtccgctccgggggtgcggccccggccgtggtcctcatggcg
agcgggtccgaggtgggactggccctggccgcggcggaaattatggccggtaacggggtt
gcggcccgcgtggtgtccatcccctgcctggaggccttcctggcccagccggaaggctac
cggcgccgctgcctgccgggccgcgtcccgcgggtggcggtggaggcggggcatggcggc
ctctggtggcggctcctgggtccggccggcctgttcatcggcctggagagcttcggcgcc
tcggccccggaaaaggtgctggccgaacagtacgggttcacccctgagctggttgcccgg
cgcgtggccgagttcgtggagcgctga

DBGET integrated database retrieval system