KEGG   Gilliamella apicola: GAPWK_2676
Entry
GAPWK_2676        CDS       T03066                                 

Definition
(GenBank) hypothetical protein
Organism
gap  Gilliamella apicola
SSDB
Motif
Pfam: TraU Pet100
Other DBs
NCBI-ProteinID: AHN27249
LinkDB
Position
complement(3009742..3010692)
AA seq 316 aa
MSRLKINIFITGILLFYNISAVNATTSITTERIIPSALSLSCADYKIVGICYWLSCSFGC
RVRTSIKVKHFIPDMVVSSYSNTGENPWIEAKMILKPLTISTSSMAQSGGDTNTRQAHNH
TKVRFKDVDALGHPGGAVFSSMLSGMGYYCSNGVTPLYPYYTSSLDFLAWRQVPLEQFYP
EALVPGVREIGSIFSANMWGNIYPRSGAVVQADDFKAAAVTAQRAADIFTNSGQAHVYRQ
YTRKHKDGFWPPSPVKENTNNHKWQILAPEMSNTCDTFPNLNKSSSLDGAYVFSLWRPYK
CCKPRGHFLYSIDWDN
NT seq 951 nt   +upstreamnt  +downstreamnt
atgagtagattaaaaataaatatatttataaccggaattttgcttttttataatattagt
gccgttaatgctactacatcaataaccactgaaagaataattccatcagcattatcgtta
tcatgtgccgattataaaattgttggaatatgctattggttatcttgttcgtttggctgt
agagttagaacgtctataaaagtgaagcacttcattccagatatggttgtttccagttat
tcaaatactggggaaaatccgtggattgaggcaaagatgatattaaaaccgttaacaata
tcaacatcttcaatggctcagtcgggaggggatacaaatacgagacaggctcataaccat
actaaggttcgatttaaagatgtcgatgcactagggcatccaggtggagctgttttctca
agtatgttatcaggaatgggatattattgttctaacggcgtaactccattatatccgtat
tatacaagttccctagatttcttagcttggaggcaagttccgcttgagcagttttatccg
gaagccttggttcctggagtaagagagataggaagtattttttcagctaatatgtgggga
aacatttatcctcggtcgggggcggtggtacaggctgatgacttcaaagcagcagcagta
acagcacaaagagctgctgatattttcacgaattcaggtcaggcacatgtctatagacaa
tatacaaggaaacataaagacggattttggcctccgtcacctgtcaaagaaaacacgaac
aaccataagtggcaaatccttgctcctgaaatgtctaacacatgcgatacgtttccgaat
ttaaataaatcatcatcactagatggggcgtatgtgttttccctttggaggccttataag
tgctgtaaacctaggggtcattttttatatagtattgattgggataattaa

DBGET integrated database retrieval system