KEGG   Glutamicibacter arilaitensis KLBMP5180: AOZ07_11860Help
Entry
AOZ07_11860       CDS       T04229                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gar  Glutamicibacter arilaitensis KLBMP5180
Pathway
gar00473  D-Alanine metabolism
gar01100  Metabolic pathways
gar01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOZ07_11860
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AOZ07_11860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gar01011]
    AOZ07_11860
Enzymes [BR:gar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AOZ07_11860
Peptidoglycan biosynthesis and degradation proteins [BR:gar01011]
 Precursor biosynthesis
  Racemase
   AOZ07_11860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALG29606
UniProt: A0A0N9JF50
LinkDB All DBs
Position
complement(2586051..2587250)
Genome map
AA seq 399 aa AA seqDB search
MNSEALEVSNVTTSTSSAQASGFERRAVIDLSAIRNNVKQISDLVAPAAVMAVVKADAYG
HGAIPVAKAAVEGGASWIGCAHVTEALALREAGIQTPMLAWLHTEDTPFEAAVDASLDLG
VSGWELERVAAAARSVQTPARIHLKIDTGLGRNGSTMDDFPDLLNRASVFQEEGLLRVVG
LFSHLAVADEPERPETDEQLEVFSKAIELVEAAGFDLEVRHIANTPAILSRPDTHHDMVR
LGLGLYGLSPFENDSPDSFGLRPAMKLVTRVANVKKVHAGQGVSYGLNYKTEGETYLGLI
PMGYADGLPRIATGAPVTVKGRSYPVRGRIAMDQCVIDLGPEISPEDYLGAEAIIFGAGG
QSVNTWAHAANTINYEVVTRISPRVPRHYVEGSWGEAGE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaactctgaagcacttgaagtaagcaacgtgacaaccagtaccagcagtgcacaggcc
agcggatttgaacggcgcgcagtgatagatctgtccgccatccgcaacaacgtcaagcag
atctccgacttggtggcccccgctgcagtcatggccgtcgtcaaagcagacgcctacggc
cacggtgctatccctgtggccaaagcggcagtggaaggcggtgccagctggatcggctgc
gcacatgtcaccgaagccctggctcttcgcgaggccgggatccaaacccccatgcttgcc
tggttgcataccgaagacaccccattcgaggctgccgttgatgccagcctcgaccttggc
gtatccggatgggagctagaacgggtagctgccgcggcgcgctcggtgcaaaccccggcc
cgcattcatctgaaaattgataccgggctgggacgcaacggatccactatggatgacttc
ccggatctgctcaaccgcgccagcgtcttccaagaagaggggctgctgcgagtggttgga
ctgttctcccacctcgcggtggcagatgagccagaacggccggaaaccgatgagcagctg
gaagtgttcagcaaggccattgagctggtggaagcggcaggcttcgatttggaagtccgc
catatcgccaataccccagccatcctctcccgccctgatacgcaccatgacatggttcgc
ctcggcctgggcctctatggactgagcccattcgaaaatgattcgccggatagttttggg
ctgcgcccagccatgaagctggtcacccgagtggccaacgtcaagaaagtgcatgccggg
caaggtgtttcctatggactgaactacaaaaccgaaggcgaaacctacctgggcttgatt
cctatgggctacgcggatggtctgccacgcattgccaccggagcaccggtgacggtgaaa
ggacgcagctatccggtgcgcggtcgcattgccatggaccagtgcgtcatcgaccttggc
ccagaaatctccccggaagactacttgggcgcagaagcaatcatctttggcgcaggaggc
caatcggtgaatacctgggcccatgctgccaacaccatcaactacgaagtagtgacgaga
atttcgccacgagtgccgcgtcattacgtggagggcagctggggtgaagccggtgaatga

DBGET integrated database retrieval system