KEGG   Glutamicibacter halophytocola: AOZ07_13245Help
Entry
AOZ07_13245       CDS       T04229                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10009  L-cystine transport system permease protein
Organism
gar  Glutamicibacter halophytocola
Pathway
gar02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gar00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOZ07_13245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gar02000]
    AOZ07_13245
Transporters [BR:gar02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    AOZ07_13245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ALG29847
LinkDB All DBs
Position
2860572..2861237
Genome map
AA seq 221 aa AA seqDB search
MDSNWQLFIDSLWPLAKGAITATIPLALISFALGLAIALLMALMRISKNPALSGIARVYI
SIVRGTPLLVQLFVIFYGMPSLGITIDPWPSAIIAFSLNIGGYAAEIIRAAILSVPAGQW
EAGYTLGMSRTRSLYRLILPQATRVAIPPLSNSFISLVKDTSLASTILVTEMFRKAQEIT
ASTYEFMLLYCEAAAIYWIICLLLSALQNSVEGKLEKYVAK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaattggcagttattcatcgattcgctctggcccctggccaaaggcgcaatc
acggcaaccattccgctggcgctgatcagctttgccctcggactggcgatcgccttgctg
atggcgctgatgcgcatcagcaaaaacccggcgctctcgggcatcgcccgggtctacatt
tcgattgttcgcggcactcccctgctcgtgcagttgtttgtcatcttctacggcatgccc
agcctgggaatcaccattgatccctggcccagtgcgatcattgccttcagcctgaacatc
ggcggctatgccgccgaaattatccgcgccgcgatcctctcggtcccggccggacagtgg
gaagccggatacaccctgggcatgtcgcgcacgcgcagcctgtaccggttgatccttccg
caggccacccgcgtggcgattcctcctctgtccaattccttcatctcattggtgaaggac
acctcgttggcctcgaccattctggtcaccgaaatgttccgcaaggcccaggagatcacg
gcctcgacctacgagttcatgctcctgtactgcgaagcggccgcgatctactggatcatt
tgcctgttgctctctgcgctgcagaactctgttgaaggaaagctggaaaagtatgtcgcc
aagtag

DBGET integrated database retrieval system