KEGG   Glutamicibacter arilaitensis KLBMP5180: AOZ07_17580Help
Entry
AOZ07_17580       CDS       T04229                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
gar  Glutamicibacter arilaitensis KLBMP5180
Pathway
gar00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:gar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AOZ07_17580
Enzymes [BR:gar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AOZ07_17580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 DUF4434 Cellulase Glyco_hydro_35 Glyco_hydro_2_C Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ALG30609
UniProt: A0A0N9JHG6
LinkDB All DBs
Position
3835122..3837200
Genome map
AA seq 692 aa AA seqDB search
MQHHRWLRTPDSKQPRLSFGADYNPEQWPREVWEEDVELMRQAGVDVVSVAIFSWAKLQP
TEDSWDFAWLDEVLELLHANGIGVDLATATASPPAWLSIKHPEILPVTSEGHTLWQGGRQ
HWRPTSPVFRGYALALVEKLAERYKDHPAIVAWHVNNELGCHNAYDYSDDAAAAFRLWLG
ERYGSIEALNHAWGTAFWAQQYGSFEHILPPRQAAAFPNPTQQLDFARFSSDALKGYLVA
ERQVLRRITPDIPVTTNFMIMGDTGFADYADWAQEVDFVSNDHYRQPVGRSRDELGFSAA
LTSGVAHGEPWFLMEHSTSAVNWQPVNRPKAPGELARDSLTHVAHGADAVCYFQWRQSSA
GAEKFHSAMVPHAGADSRIFRDVVALGQRLGQLGPVLGSGRAPSRVAILFDWQSWWGSEL
DSHPSDRLRYRDEAFAWWCALIDAGVRADVVPASHDFSGYDMVIAPVLYSVPRPLAGRLE
DYAQSGGHLVTTYFSGIVDENDHARLGGYPGALREVLGIRVEEFRPLHHGESVSLGAVPG
QGELWTEIVDVIAQEVAVLATFEQDEELGGLPAVTRRALESGSASYVATRLNAESRAAVL
DKLLEAAGIESELPEQLRGQVEFALRRGEEADYAFLINRTNTELSLEGFEGQVIGGEDAP
GGRGTLAGRAVAVLEVARDRSRELEAESAGVR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaccaccgctggttgcgaactcccgattcgaagcagccgcgcctttccttcggc
gccgattacaaccccgagcagtggccccgcgaggtctgggaagaagatgtcgagctcatg
cgccaggcaggggtggacgtggtcagcgtcgcgatcttctcctgggccaagctgcagccc
accgaggacagctgggacttcgcctggctcgacgaggtgctggagctgctgcacgccaac
gggatcggcgtggatctggccaccgccaccgcctcgccgccggcctggctgagcatcaag
caccccgaaattctgccggtgaccagcgaagggcacaccctgtggcagggcggccgccag
cactggcgcccaaccagcccggtgttccgcgggtacgcgctcgcgctggtggaaaagctg
gccgaacgctacaaggaccacccggcgattgtggcctggcatgtgaacaacgagctgggc
tgccacaacgcctacgactactccgatgacgccgcggcggccttccggctctggctgggc
gaacgctatggcagcatcgaggcgctgaaccacgcctggggcaccgccttctgggcccag
cagtacggcagcttcgagcacatcctgccgccgcggcaggccgccgccttcccgaacccc
acccagcagctggacttcgcccgcttcagctccgacgcgttaaaggggtacctggttgcc
gagcgccaggtgctgcgccgcatcacccccgacatcccggtcaccaccaacttcatgatc
atgggcgataccggattcgccgactacgccgactgggctcaggaagtggacttcgtctcc
aacgaccactaccgccagccggtgggccgctcgcgggacgagctgggcttctcggcggcg
ctgacctccggggtggcgcatggggaaccctggttcctgatggagcattccaccagcgcg
gtgaactggcagccggtcaaccggcccaaagccccgggagagctggcccgcgactcgctg
acccatgtggcccatggcgccgacgcggtctgctacttccagtggcgccagtcctccgcg
ggagcggagaagttccactcggccatggtgccgcacgccggcgctgactcgcggatcttc
cgcgacgtggtggccctgggccagcgcctgggccagctcggcccggtcctgggcagcggc
cgtgcaccctcccgcgtggcgatcctgttcgattggcagtcctggtggggcagcgaattg
gactcgcaccccagcgaccggctgcgctaccgcgacgaggccttcgcctggtggtgcgcg
ctgatcgacgccggcgtgcgtgccgatgtggtgccagccagccacgacttctccggatac
gacatggtgattgcgccggtgctgtattcggtgccgcggcccctggccgggcgcctggag
gactacgcccagtccggcgggcacctggtcaccacctacttctccggcatcgtcgatgaa
aatgaccatgcccggctgggcggctaccccggcgccctgcgcgaggtgctgggcatccgg
gtcgaggagttccgccccttgcaccacggcgaatcggtatcccttggcgcagtgccgggc
cagggcgagctgtggaccgagatcgtggatgtcatcgcgcaagaggtcgcggtgctcgcc
acctttgagcaggacgaggagctcggcgggttgccagcggtcacccgccgcgccctggag
tccggcagcgccagctacgtggcgacccggctgaatgccgagtcccgcgcggcggtcctg
gacaagctgctggaggccgcaggcatcgagtccgaactgcccgaacagctgcgcggccag
gttgagttcgccttgcgccgcggcgaggaggctgactatgccttcctgatcaaccggacc
aacaccgagctgagcctggaaggcttcgagggccaggtcatcggcggggaggatgcaccg
ggcggccggggcacgctggccgggcgggcggtggccgtgcttgaggtggcccgcgatcgc
tcccgcgagctggaagccgaaagcgccggcgtgcgctag

DBGET integrated database retrieval system