KEGG   Gemmatimonas aurantiaca: GAU_0866Help
Entry
GAU_0866          CDS       T00878                                 

Definition
(GenBank) putative glycosyltransferase
Organism
gau  Gemmatimonas aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: BAH37908
NITE: GAU_0866
UniProt: C1A6P8
LinkDB All DBs
Position
complement(1038689..1039972)
Genome map
AA seq 427 aa AA seqDB search
MNVGTLVSVSNVVLWFCIAVLAIYTLRHYFFTLNRLFGRHRQPFVDILQADWPSLVVFVP
AHNESRVVRDSLDALLTCDYPEDRLKIVPIDDRSSDDTRSILVEYAENYPGRVIPFLRDD
GIPGKAAALADAMALHTDEVFLVFDADYIPGTRLLKQLVSPFFDPEVGAVMGRVVPLNVG
VSLLTRLLDLERAGGYQVDQQARMNLRLVPQYGGTVGGVRRAALDHVGGWRVDSLAEDTD
LTVRLVIAGWEVVYQNRSECYEEVPETWESRIRQIKRWAKGHNQALRRYLGALIRNRSDL
PFWQVLDGVLLLGVFVVPLVLLAGWLCTIALFYAGYPPQWGRVTILAISSFNTVGNFAAF
FQVAAASRLDGSRERIRMLPFLFLGFLVSTVSVGRASLSRASWLRGQPVQWQKTERHRES
RVQSRSK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcggtaccctggtgagcgtgtccaatgtggtgctgtggttttgcatcgcggtg
ctcgcgatctacacactgcggcactacttcttcacgctgaaccggctgttcgggcgtcat
cggcagccgtttgtcgacatcctgcaggcagactggccctcactcgtggtgtttgtgccc
gcgcacaacgagtcgcgcgtggtgcgcgattcgctcgacgcgctgctcacctgtgactat
ccggaagatcgcctcaagatcgtccccatcgacgatcgatcgagcgacgacacacgcagt
atcctggtggagtacgccgagaactatcccgggcgtgtcatccccttcctgcgcgacgat
ggcattcccggcaaggccgccgcgctcgccgacgcgatggcgctgcacaccgatgaagtg
tttctggtgttcgacgccgactacatccccggcacgcggctcctgaagcagctcgtgtca
ccgttcttcgatcccgaagtcggcgcagtcatgggacgcgttgtgccgctgaacgtgggc
gtgtcgctgctcacgcgcctgctcgatctcgagcgggccggtggttatcaggtcgaccag
caggcccgcatgaatctgcgcctcgtgccgcagtatggcggtaccgtcggcggcgtgcgt
cgtgcggcattggatcacgtgggcggctggcgtgtggactcgctggccgaagacaccgat
ctcaccgtgcgtttggtgattgccggttgggaagtggtctatcagaaccggtctgagtgt
tatgaagaggtgccagagacctgggaatcgcgcatccggcagatcaagcgctgggcgaag
gggcacaatcaggctctgcgtcgctacctcggcgccctgatccgcaatcgcagcgacctt
ccgttctggcaggtactcgacggcgtgctgttgctcggtgtattcgtggtgccgctggtg
ctgttggcaggatggctctgcaccatcgccctgttctatgccggctatccgccgcagtgg
ggacgtgtcaccattctggcgatttcgtccttcaacaccgtcggcaacttcgccgcgttc
ttccaggtggcggcggccagtcgattggatggttcacgtgagcgcatccggatgctgccg
ttcctcttcctcgggttcctggtgagcaccgtgtcggtaggccgggcatccctgtcacga
gcgtcgtggttgcgtggtcagcccgtgcagtggcagaagacggaacgtcatcgcgagtca
cgtgtgcagtcgaggagcaagtga

DBGET integrated database retrieval system