KEGG   Gemmatimonas aurantiaca: GAU_1548Help
Entry
GAU_1548          CDS       T00878                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00970  Aminoacyl-tRNA biosynthesis
gau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gau00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GAU_1548 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gau03029]
    GAU_1548 (gatB)
Enzymes [BR:gau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GAU_1548 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GAU_1548 (gatB)
Mitochondrial biogenesis [BR:gau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GAU_1548 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAH38590
NITE: GAU_1548
UniProt: C1A8N0
LinkDB All DBs
Position
1857404..1858843
Genome map
AA seq 479 aa AA seqDB search
MSTNWELVIGLEVHCQLKTRSKIFCGCATSFGEAPNTNTCPVCLGLPGALPVLNAEAVHL
ATRASLALGCTVHEASVFARKNYFYPDLPKGYQISQFDRPLATEGAVVIGVQSDGTPRVI
RVHRVHMEEDAGKSVHDRFRDVSAIDLNRAGTPLVEIVSEPDIRTGAEAGAYARRMKQIL
EYADVSDANMEEGSLRVDVNISIRPSSTSPFGTKTEIKNLNSFSAIERAVEIEFARQVRV
LESGGTIEQQTMLYDDKRNEVRPARSKEGSHDYRYFPEPDLPPLRLASAYVESIRAALPE
LPEAKRQRFAAEYGLGDVDVEQLIVEASLADHFEVVARASGDARRAANWMLGAVLASVNA
SGRSLAEHPVTAERLGALIKLEAAGDVSNTAARQLFALMEQESGEPLELAKREGLVQVRD
DSALVGWIDEVFAENPAEAARFAGGEKKLQGVLVGLVMKKSKGAADPKKVNQLLGARAG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaactgggaattggtcatcgggctcgaggtacactgccagctcaagacccgc
agcaagattttctgtgggtgcgcgacgtcgtttggtgaggctcccaacaccaacacctgc
ccggtatgtctgggtttgccgggagcgttgccggtactgaacgcggaagcggtgcacctc
gccacacgcgcgtcactggcgcttggctgcacggtccacgaagcctcggtcttcgcacgc
aagaattacttctatcccgacctgcccaagggataccagatctcgcaattcgatcgtcct
ctcgccacggaaggcgcggtcgtgatcggtgtgcagtccgacggcacacctcgcgtcatt
cgagtgcatcgtgtgcacatggaagaagacgccgggaagtcggtgcacgatcgattccgg
gatgtgtcggccatcgatctcaatcgcgctggcacgccgctcgtggagatcgtgtcggag
ccggacattcgcaccggcgcagaagctggcgcctacgctcggcgcatgaagcagatcctc
gaatatgccgacgtgtccgatgcgaacatggaagagggttcgctgcgggtcgacgtcaac
atttccattcgcccgtcgagcaccagcccgttcggcaccaagaccgagatcaagaatctc
aattcgttctcggccattgagcgcgcggtggagatcgaattcgcgcggcaggtacgtgtg
ctcgagagtggtgggacgatcgaacagcagacgatgctgtacgacgacaagcgcaacgaa
gtccgtccggcacgcagcaaggaaggcagccacgactatcgctacttccccgagccggac
ttgccgccgctgcggctggccagcgcgtatgtggagagcattcgcgcggctctgccggag
ttgccggaagccaaacggcagcgcttcgccgccgaatacgggttgggcgacgtggatgtc
gagcagctcatcgtggaggcgtcgctggccgaccacttcgaggtggtggcacgcgcgtca
ggtgatgcgcgtcgtgcggcgaactggatgttgggcgccgtgctcgcatcggtgaatgca
tcgggacggtcattggccgagcatcccgtgaccgccgaacgcctgggtgcattgatcaag
ctcgaggcggcgggtgatgtatccaacacggccgctcgtcagctctttgcgctcatggag
caggagtccggagagccgctcgagttggcgaaacgcgaaggactcgtgcaggtgcgcgat
gactccgcactcgtcggttggatcgatgaagtcttcgccgaaaaccctgccgaagccgca
cgttttgccggcggcgaaaagaagttgcagggggtgttggttggactcgtgatgaagaag
tccaagggggccgcggaccccaagaaggtcaaccagctacttggcgcacgcgcggggtga

DBGET integrated database retrieval system