KEGG   Gemmatimonas aurantiaca: GAU_2329Help
Entry
GAU_2329          CDS       T00878                                 

Gene name
idh
Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00020  Citrate cycle (TCA cycle)
gau00480  Glutathione metabolism
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01130  Biosynthesis of antibiotics
gau01200  Carbon metabolism
gau01210  2-Oxocarboxylic acid metabolism
gau01230  Biosynthesis of amino acids
Module
gau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gau_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GAU_2329 (idh)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GAU_2329 (idh)
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GAU_2329 (idh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAH39371
NITE: GAU_2329
UniProt: C1AAW5
LinkDB All DBs
Position
complement(2722973..2724379)
Genome map
AA seq 468 aa AA seqDB search
MAAARETGPHYWLHRGSGRILRCSPCCEARNTALAGMENVDVFLVAASVAVHGPSSAPPG
ILRMAKIKVVNPVVEMDGDEMTRIIWQFIKDKLILPYLDVELDYYDLGIEHRDATGDQVT
IDSAEATKKHGVAVKCATITPDEARVKEFGLKKMWKSPNGTIRNILGGVIFREPIIISNI
PRLVPHWTKPIVVGRHAHGDQYKATDFKVPGPGTVTITYQPADGSAPMQFDVAKFGQDGG
VAMGMYNYNDSIKDFARASFRYGLQRNFPVYLSTKNTILKAYDGQFKDLFEDVFDAEFKA
EFEKAGITYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLLT
PDGKTMEAEAAHGTVTRHYREHQKGNKTSTNPIASIFAWTRGLMHRGKVDGTPDVVRFAE
TLEQVCIEAVEAGEMTKDLAILISKDTPYLHTENFLDAIDRRLQAKMA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagctcgcgagaccgggccccactactggctccatcgcggttccgggcgcatc
ttgcggtgttccccatgttgcgaggctcgcaataccgctttggccggcatggagaacgtc
gacgttttcctcgtggccgcctcggtggcggtgcacggtccctcttcagccccacccggc
attctgcgtatggcgaagatcaaggtcgtgaatcctgtcgtcgagatggacggcgacgag
atgacccgcatcatctggcagttcatcaaagacaagctcatcctgccgtatctcgacgtc
gaactcgactactacgacctcggcatcgagcaccgcgacgcgacgggcgatcaggtcacg
atcgactccgccgaagccaccaagaaacacggtgtggcggtgaagtgtgcgaccatcacg
cccgatgaagcgcgtgtgaaggagttcgggctcaagaagatgtggaagagccccaacggc
accatccgcaacatcctcggcggcgtgatcttccgcgagccgatcatcatttcaaacatt
ccgcgcctcgtgccgcactggaccaagcccattgtcgtgggccgtcatgcgcatggtgat
cagtacaaggcgacggacttcaaggtgccgggtcctggcacggtgaccatcacctaccag
ccggccgacggcagcgcgccgatgcaattcgacgtggccaagttcggccaggacggcggc
gtggcgatgggcatgtacaactacaacgactccatcaaggactttgcgcgcgcatcgttc
cgttacggtctgcagcgcaacttcccggtgtacctctccacgaagaacaccatcctcaag
gcctatgatggccaattcaaggacctcttcgaggacgtgttcgacgccgagttcaaggcg
gagttcgagaaggccggcatcacgtatgagcaccgcctgatcgacgacatggtcgcctcg
gcgctcaagtgggaaggcggctacgtgtgggcgtgcaagaactacgatggcgacgtgcag
tcggacatcgtggcgcagggcttcggttcactcggtctcatgacgtcggtgctgctcacc
cctgacggcaagacgatggaagccgaggcggcgcacggcacggtgacgcgtcactaccgt
gagcaccagaagggcaacaagacgtcgaccaaccccatcgcgagcatcttcgcgtggacg
cgtggtctcatgcaccgcggcaaggtggacggcacgcctgatgtggtgcgcttcgcggag
acgctggagcaggtgtgcattgaagcggtggaagccggcgagatgaccaaggatctggcg
atcctcatttccaaggacacgccgtatctgcacacggagaatttcctcgacgcgatcgat
cgccggttgcaggcgaagatggcgtaa

DBGET integrated database retrieval system