KEGG   Gemmatimonas aurantiaca: GAU_2688Help
Entry
GAU_2688          CDS       T00878                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00010  Glycolysis / Gluconeogenesis
gau00071  Fatty acid degradation
gau00350  Tyrosine metabolism
gau00625  Chloroalkane and chloroalkene degradation
gau00626  Naphthalene degradation
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01130  Biosynthesis of antibiotics
gau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GAU_2688 (adh)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GAU_2688 (adh)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GAU_2688 (adh)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GAU_2688 (adh)
   00626 Naphthalene degradation
    GAU_2688 (adh)
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GAU_2688 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: BAH39730
NITE: GAU_2688
UniProt: C1AAD2
LinkDB All DBs
Position
complement(3160219..3161244)
Genome map
AA seq 341 aa AA seqDB search
MQKTMKAAVVRAFGEPLVIEEAPVPDVGRGQILVKIAASGVCHTDLHAAEGDWPIKPTPP
FIPGHEGVGHVVALGAGVTHLREGDRVGVPWLYSACGHCVHCLGGWETLCEQQHNTGYSV
NGGFAEYVVADANYVGVLPDNVGFVEIAPVLCAGVTVYKALKVTDTKPGDWVVISGIGGL
GHMAVQYAKAMGLNVAAVDIDDRKLALASTLGATFTVNARNEDPGARIRKEIGGARGVLV
TAVSPKAFQQALGMVRRGGVVALNGLPPGDFPISIFDTVLNGITIRGSIVGTRLDLQEAL
AFAGEGKVHATVQTGKLEQVNDIFARMRAGDIEGRVVLDLR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaccatgaaggcggcagtggtccgcgcctttggcgagccgctggtcatcgaa
gaagcgcccgtgccagatgtgggacgtggacagattctcgtgaagatcgcggcgtccggt
gtctgtcataccgatctgcatgcggccgaaggcgattggcccatcaaacccacgccgccg
ttcattcccgggcatgaaggggtcggacatgttgtcgcccttggtgctggtgtcactcat
ctgcgcgaaggtgatcgggtgggcgtgccgtggctctacagcgcttgtgggcactgcgtc
cactgtcttggaggatgggaaacgctgtgtgagcagcagcacaacactggttattccgtc
aacggcgggttcgccgagtacgtcgtggccgacgccaactacgtgggcgtcttgccggac
aacgtcggctttgtcgagatcgcgccggtgctgtgcgccggtgtgacggtctacaaggcg
ctcaaggtgaccgacaccaagccgggcgactgggtggtcatctctggtatcggtggattg
gggcacatggcggtccagtatgccaaggcgatggggttgaacgtcgccgcagtcgacatc
gacgaccgcaagctggcgctggcgtccaccctcggggcgaccttcacggtcaatgcgcgg
aacgaggatcccggtgcccgcatccgcaaggaaattggtggagcgcggggcgtgctcgtg
acggcggtttccccgaaggcctttcaacaggcgctgggcatggttcgtcgaggcggggtc
gtcgcgctcaatggactgccgcctggtgatttcccgatctcgatcttcgacacggtgctg
aacggcatcacgatccgtgggtcgatcgtgggcacgcgtctggatctccaggaggcgctc
gccttcgccggggaaggcaaagtccatgcgacggtgcaaaccggaaagctggagcaggtc
aacgatattttcgcacgcatgcgcgccggtgatatcgaaggccgggtcgtactcgacctg
cgttga

DBGET integrated database retrieval system