KEGG   Gemmatimonas aurantiaca: GAU_3259Help
Entry
GAU_3259          CDS       T00878                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00330  Arginine and proline metabolism
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01130  Biosynthesis of antibiotics
gau01230  Biosynthesis of amino acids
Module
gau_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    GAU_3259 (proC)
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     GAU_3259 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 ApbA PDH IlvN 2-Hacid_dh_C 3HCDH_N NAD_Gly3P_dh_N Rossmann-like GFO_IDH_MocA Shikimate_DH DapB_N
Motif
Other DBs
NCBI-ProteinID: BAH40301
NITE: GAU_3259
UniProt: C1ACS4
LinkDB All DBs
Position
3864629..3865429
Genome map
AA seq 266 aa AA seqDB search
MKIGIIGMGKMGEAVAQGLAKYGVEATLRGSTRTEESAADVRERLGMACTTNNAEAAQGA
EIVLLCVKPHQAERVLREIAPVITADQLLLSICASITTRQLAEWSGDKATVIRAMPNTPC
LIGEGMTVFSAGTGVRPQHLEAAERIFGPLGRTAVVEESLMDGVTGLSGCGPAYVYLIIE
SLSEAGVKIGLSRETATLLAAQTLAGASRMVLERGVHPAALKDEVTTPAGCTIDGLMALE
EGKLRVTLIKGVLAATERSKSLRNNA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcatcatcggcatgggcaagatgggcgaggccgtggcgcagggactcgcg
aagtacggtgtggaagccacattgcgcggctccacacgtaccgaggagagtgccgccgac
gtgcgcgagcgcctgggcatggcctgcaccaccaacaacgctgaagcggcgcagggcgcg
gaaatcgtgctgctgtgcgtgaagccgcatcaggcggaacgtgtactgcgcgagatcgcg
ccggtgatcacggccgatcagttgctgctctcgatctgcgcgtccatcaccacgcgacaa
ctcgccgagtggtcgggcgacaaggccaccgtcatccgtgccatgcccaacacgccgtgc
ctgatcggcgaaggcatgacggtgttcagcgccggcacgggtgtgcggccgcagcacctc
gaagcggcggagcgcatcttcgggccgttgggacgtacggccgtggtggaagagtcgctg
atggatggcgtgaccggtctcagtggctgcggaccggcgtacgtctacctgatcatcgaa
tcgctgagtgaagccggtgtgaaaatcggcctgtcacgcgaaacggccacgctgctcgcg
gcccagaccctggccggtgcatcgcgcatggtgctggagcgtggtgtacatcccgcggcg
ctcaaggatgaagtcacgacgccagccggctgcaccatcgatggcctgatggcactggaa
gaaggcaagctgcgtgtgacgctcatcaagggggtgttggcggctacggaacgcagcaag
agcctgcgcaacaacgcctag

DBGET integrated database retrieval system