KEGG   Gemmatimonas aurantiaca: GAU_3748Help
Entry
GAU_3748          CDS       T00878                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00620  Pyruvate metabolism
gau00680  Methane metabolism
gau01100  Metabolic pathways
gau01120  Microbial metabolism in diverse environments
gau01200  Carbon metabolism
Module
gau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GAU_3748 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    GAU_3748 (ppc)
Enzymes [BR:gau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GAU_3748 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: BAH40790
NITE: GAU_3748
UniProt: C1AE63
LinkDB All DBs
Position
complement(4399586..4402387)
Genome map
AA seq 933 aa AA seqDB search
MTDILDPPPARDEKDRPLRDDIRLLGRLLGDAVREQEGADVFQLVEDTRRAAIRFAREGR
AEDREALHVLLDPLPPDTMLSVVRAFSYFLQLANIAEDTHRGRRRRAHEVMGSRPREGTL
EFALEMVRQAIGNDGLAQERLTAFFRSALVSPVLTAHPTEVQRQSTLTVMQQIATLLEQR
DRMVLTGEERTESDALLTRLVLTLWHTRIVRGERLRVVDEVKNGIAYFRSTFFTEVPRLH
ANLEDLLSAQFPGSTWQLTPFLQPGSWIGGDRDGNPFVTADVLHETLRLQASATFDFYLQ
EIHALGQQLSLSRTLHAVTPALEALAARSPDTSAQRLDEPYRRALSGIYARVASTMSGLE
LPPPVRAALGSGEPYASADALYDDLVIIRDALTTTGVGLLAAGRLRRLLMAVQGFGFHLA
PLDLRQNADVHERVVTELFAQAGVCDNYAALDESQRVALLARELEGTRPLHSPHLRYSEE
VAGELAIVFTAARLRQRYGASALPHYVISKCDGVSDLLEVALMLKEAGLATGGQQATLGL
DIVPLFETIADLRRAGDTMRAALALPVYRALLRTRGDVQEVMLGYSDSNKDGGFLTSGWE
LYQAQTALMQAFGDAGVQLRFFHGRGGSVGRGGGPSYDAILAQPAGAVTGQIRLTEQGEV
IASKYATPDVGRRNLELLVAATLEATLTDHESGADQVTAFRPVMERLSAHAYAAYRALVY
ETPGFAQYFRESTPLAEIATLNIGSRPASRKPSDRIEDLRAIPWVFAWAQCRCMLPGWYG
FGSAVTAWLVEQPDGLPVLQRMAQHWPFFRTLLSNVDMVLAKSDLRVASRYSELVQDETL
RRTIFAAIEAEWHRTRDALRQITGQDQLLADNPLLVRSMANRFPYMDPLNHLQIALLQRH
REHVASGTAPDDLMRRGIHITINGIAAGLRNSG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcgacccacctccagcgagggacgagaaggaccgtcccctccgcgac
gatatccgcctcctgggccgcctgctgggtgacgcggtccgtgagcaggaaggggctgat
gtcttccagctcgtggaggacactcggcgcgcggccatccggttcgcccgggaaggtcgg
gccgaggaccgggaggcgctgcatgtcctgctggatccactgccgcccgacacgatgctc
agcgtggtgcgtgcgttttcgtacttcctgcagttggccaacatcgccgaggacacccac
cgcggccgccggcgacgcgcccacgaagtcatgggctctcggccgcgcgaaggcacgctg
gagtttgccctcgagatggtccgtcaagcgatcggcaacgacggcctcgcacaggagcgt
ctgacggccttctttcgcagtgcgctcgtctcaccggtgctcacggcacaccccaccgag
gtacagcgacagagtacgctcaccgtcatgcagcagattgccacgctgctcgagcagcgc
gatcgcatggtgctcacgggagaagagcgcacggaaagtgatgccctgctcacgcgcctc
gtgctcacgctctggcacacgcgcatcgtacgcggcgagcgcctgcgggtcgtggacgaa
gtgaagaacggcatcgcgtattttcgcagcacgttcttcaccgaggtgccgcgcctgcat
gcaaatctcgaggatttgctatcagcgcagttccccggcagcacctggcaactgacgcct
tttctacaacccggcagttggatcggcggcgatcgtgatggcaatccgtttgtcacggcc
gatgtgttgcacgagacactgcgcctgcaggcgtcggcgacattcgatttttatctgcag
gagattcacgcactcggacagcaattgtcgctgtcacgcaccttgcatgcggtgacgccg
gcactggaagccctggccgcacgctcacccgataccagcgcgcagcgtctcgacgaaccg
tatcgtcgcgcactgagcggcatctacgcgcgggtcgcgtccaccatgagtgggctcgaa
ctgccaccaccggtgcgcgcggcactgggcagcggtgagccgtatgcctccgccgatgcg
ctgtacgatgacctcgtcatcatccgcgatgcactcacgaccacgggtgtgggtctgctc
gccgccggacggctgcgtcggttgctgatggcggtgcagggattcggcttccatctcgca
ccactcgatctgcggcagaacgccgatgtgcacgaacgtgtggtcacggagctgttcgcg
caggctggggtgtgcgacaattatgcggcgctcgacgaatcgcaacgggtggcgttgctg
gcccgcgagctcgagggcacgcgtccgctgcattctccgcatctgcgttacagcgaagaa
gtggccggtgagctggcgatcgtcttcacggccgcccgcctgcggcagcgttatggcgcg
agtgcgttgccgcactacgtgatctccaagtgtgatggtgtatcggacttgctggaagtg
gcactgatgctgaaggaagcagggctcgccacgggtggtcagcaggccacgctgggcctc
gatatcgtgccattgttcgaaaccattgccgacctgcggcgtgctggtgacacgatgcgt
gcggcgctcgcgctgccagtgtatcgcgcactcctgcgtacccgcggtgacgtgcaggaa
gtgatgctggggtattccgacagcaacaaggatggtggctttctcaccagtggctgggag
ctgtatcaggcgcagactgcgctgatgcaggcgttcggggacgccggggtgcagttgcgg
ttctttcatggtcggggtggcagtgtgggacgcggtggtggacccagctacgacgccatc
ctggcacagcccgcaggggcggtgaccggtcagattcgcctcaccgaacaaggcgaggtc
attgcctccaaatacgccacgcccgatgtgggacgccgcaatctcgagttgctggtggcg
gccacactggaggccacactcaccgaccatgaaagcggtgctgatcaggtgacggcattc
cgtccggtcatggagcgcctctccgcgcacgcttatgcggcgtatcgtgcgctggtgtac
gaaacgcccggattcgcgcagtactttcgcgagagtacaccgctggccgaaatcgccaca
ctcaacatcggcagtcgaccagcgagtcggaaaccgtccgatcgcatcgaagatctgcgc
gccattccctgggtgtttgcctgggcgcagtgccgttgcatgctgcccggatggtacggc
ttcggcagtgcggtgacggcatggctcgtagagcagcccgatggactacccgtattgcag
cgcatggcgcagcactggccattcttccgcacactgctgtccaacgtggacatggtgttg
gccaagagcgacctgcgggtggcgtcgcgctactcagagctggtgcaggacgaaacgctg
cgtcgtaccatcttcgcggccatcgaagccgaatggcatcgcacgcgcgacgcattgcgg
cagatcaccggacaggaccaactgctggccgacaacccgctgctcgtgcgctccatggcc
aaccggttcccgtacatggatccgctcaatcacctgcagatcgccctgctgcagcgccat
cgtgagcacgtcgcctccgggaccgcgcccgatgatctcatgcggcgcggcattcacatc
acgatcaacggcattgctgcggggttgcgcaattcagggtga

DBGET integrated database retrieval system