KEGG   Gordonia alkanivorans: C5O27_01025Help
Entry
C5O27_01025       CDS       T05876                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gav  Gordonia alkanivorans
Pathway
gav00071  Fatty acid degradation
gav00280  Valine, leucine and isoleucine degradation
gav00281  Geraniol degradation
gav00310  Lysine degradation
gav00360  Phenylalanine metabolism
gav00362  Benzoate degradation
gav00380  Tryptophan metabolism
gav00410  beta-Alanine metabolism
gav00627  Aminobenzoate degradation
gav00640  Propanoate metabolism
gav00650  Butanoate metabolism
gav00903  Limonene and pinene degradation
gav00930  Caprolactam degradation
gav01100  Metabolic pathways
gav01110  Biosynthesis of secondary metabolites
gav01120  Microbial metabolism in diverse environments
gav01130  Biosynthesis of antibiotics
gav01212  Fatty acid metabolism
Module
gav_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C5O27_01025
   00650 Butanoate metabolism
    C5O27_01025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C5O27_01025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C5O27_01025
   00310 Lysine degradation
    C5O27_01025
   00360 Phenylalanine metabolism
    C5O27_01025
   00380 Tryptophan metabolism
    C5O27_01025
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C5O27_01025
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C5O27_01025
   00281 Geraniol degradation
    C5O27_01025
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C5O27_01025
   00627 Aminobenzoate degradation
    C5O27_01025
   00930 Caprolactam degradation
    C5O27_01025
Enzymes [BR:gav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C5O27_01025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 UPF0444
Motif
Other DBs
NCBI-ProteinID: AZZ79852
UniProt: A0A3T0UUR3
LinkDB All DBs
Position
complement(229771..230436)
Genome map
AA seq 221 aa AA seqDB search
MSDAVLVERRGRILVITINRPQARNAINHEVSQSLADAMDELDDSPELSVAILTGAGGNF
CAGMDLKAFAAGESVAIEGRGLGFTQKPPAKPVIAAVEGYALAGGTELVLATDLVVASKS
AKFGIPEVKRGLVAGAGGLLRLPKKIPYQKALELALAERITENGPLAVAVTKRIIAESES
WSDDEKWDRQGRLLAPVFTSKDAIEGARAFAEKRKPEWTGA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcagttctcgtggagcgccgggggcgcatcctcgtcatcacgatcaaccgg
ccacaggcgcgcaacgcgatcaaccacgaagtgagccagtcgctcgccgacgcgatggac
gagctcgacgacagtccggagctgtcggtcgccatcctgaccggcgcgggcgggaacttc
tgcgcgggaatggatctgaaggccttcgcggccggcgagtcggttgccatcgagggtcgc
ggtctgggcttcacacagaagccgccggccaagcccgtcatcgccgccgtcgagggctac
gcactcgcgggcggaaccgagctggttctcgcgaccgacctcgtcgtcgcgtcgaagtcg
gcgaagttcggcatccccgaggtcaagcgcggcctcgtcgcgggcgccggtggacttctc
cggctgcccaagaagatcccgtaccagaaggccctcgaattggcgctggcggaacgcatc
accgagaacggtccactggccgtcgcggtcaccaagcggatcatcgccgagtcggaatcg
tggagcgacgacgagaagtgggaccgccagggtcgcctgctcgcgccggtcttcacctcg
aaagatgcgatcgagggcgcccgcgcgttcgccgagaagcgcaagcccgagtggaccggc
gcctga

DBGET integrated database retrieval system