KEGG   Gordonia alkanivorans: C5O27_02610Help
Entry
C5O27_02610       CDS       T05876                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
gav  Gordonia alkanivorans
Brite
KEGG Orthology (KO) [BR:gav00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C5O27_02610
Enzymes [BR:gav01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C5O27_02610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AZZ80123
UniProt: A0A3T0UVD6
LinkDB All DBs
Position
complement(559634..560887)
Genome map
AA seq 417 aa AA seqDB search
MKSFRCRLPVRTRGRAPLVSIVACGLVLSGCSFDGSATETNPELKQVDVAAMTATLDDTI
EELLVPGALALIQTPAGTYTVSAGTTTMGDDIPRAVADQFRIGSVTKTMTVAAVLQLIQE
GKIGVDDPIDKYVLGVPEGSEITIAQLMSMRSGLHNYLDTDGFRAAFGSDPTKVWAPSEL
LALGFSQPSGFAPGTQFDYSNTNTVRLGLVVEKAEDKSLAQVFADRFFGPLGLTRTSLPA
ATDTTLSAPFSHGYQYGPLQVSDKPMTPEETAAARAGSLLPNDVTVMSPSWAWAAGGVVS
TADDLMTWIKAFVGGDLLDDANQQLWWDSIRIQHDEDPRVFYGYGITEVRFGENRLTYHE
GQLPGFNTMAVHDEANDVSMVVWTNLSVTQDVDNAFTVMARLLQHIYNTPADTPPAR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagcttccgatgtcggctgccggtacggacgcgcggccgtgcaccgctcgtctcc
atcgtcgcgtgtggcctggtcctgtccgggtgctccttcgatggctcggcgacggagacg
aatcccgaactcaaacaggtcgatgtcgcggcgatgaccgcaaccctcgacgacacgatc
gaggaactcctggtacccggcgccctcgcgctgatccaaaccccggcaggcacgtacacc
gtctcggccggcaccacgacaatgggtgatgacatcccgcgcgcggtcgccgaccagttc
cggatcggatcggtcaccaagacgatgaccgtcgccgcagtgttacagctgatccaggaa
gggaagatcggcgtcgacgacccgatcgacaaatacgtcctcggcgttcccgagggttcc
gagatcaccatcgcgcagttgatgagcatgcgcagtggattgcacaactacctcgacaca
gacggattccgtgctgccttcggatcggatccgacgaaggtgtgggccccgtccgagctc
ctggccctcggcttttcccagccctcgggcttcgcgccgggcacgcagttcgactactcc
aacaccaacaccgtccggctgggcctggtcgtggagaaggcggaggacaagtccctcgcg
caggtgttcgccgaccggttcttcgggcctctcggcctgacccgtacctcgcttcccgcc
gcgaccgacacgaccctctcggcgccgttctcgcacggatatcagtatggcccgctgcag
gtctcggacaagccgatgacgcccgaggagaccgcggcggcgagagccgggtccctgcta
cccaacgatgtgacggtgatgagcccctcgtgggcctgggcggccggtggcgtcgtctcg
accgccgacgacctgatgacctggatcaaggcgttcgtcggcggagatcttctcgacgac
gccaaccagcagctgtggtgggacagcattcggatccagcacgacgaggatccccgggtg
ttctacggctacgggatcaccgaggtccggttcggggagaaccgcctcacctatcacgag
ggccagctccccggtttcaacacgatggcggtccatgacgaggcgaacgacgtcagcatg
gtcgtctggaccaatctctcagtcacacaggacgtcgacaatgcgttcaccgtgatggcg
agactgctacagcacatctacaacaccccggcggacacaccaccagcacggtga

DBGET integrated database retrieval system