KEGG   Gordonia alkanivorans: C5O27_03120
Entry
C5O27_03120       CDS       T05876                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
gav  Gordonia alkanivorans
Pathway
gav00300  Lysine biosynthesis
gav00550  Peptidoglycan biosynthesis
gav01100  Metabolic pathways
gav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    C5O27_03120
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5O27_03120
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C5O27_03120
Enzymes [BR:gav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     C5O27_03120
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: AZZ80210
UniProt: A0A3T0UVM7
LinkDB
Position
complement(664407..665720)
AA seq 437 aa
MHFLASEVAASVGGELIGPDVQIDGASIDSRNVRPGQLFVPIVAERDGHDFIPSALESGA
AAYFTSRAEVSRGTAIRVPDTALALADLGRAVRGRIPDRVVGITGSVGKTSTKDLLAGVL
QTTYRTAASEKSFNNELGLPLTLAGAADDVEAVVLEMGARGIGHIDLLCSIASPTVGVIT
RVEGVHLELFGDIESVARAKGELVESLPADGIAVLNADHRYVAAMAERTSARVLRYGLSP
DADVYASDIVVDDELRASFRLHTPWGSTDVRLGARGEHQVRNALAAAAAGGGLGVSVEDI
ANGMSAAELSGLRMELAKNADGTIVLNDAYNANPTSMSAALKSLAALPAGRRVAVLGTMA
ELGSDSPAQHHAIALEAHELDIEVIAVDEPDYGDTARHTSGVDEAVAALGDLAGGDAVLV
KGSRVAALERVAQALLS
NT seq 1314 nt   +upstreamnt  +downstreamnt
gtgcatttcttggcgagtgaggtcgcagcgtccgtcggcggcgagttgatcggtcccgac
gtgcagatcgacggggcgagcatcgactcgcgcaatgtccggccgggtcagctcttcgtg
ccgatcgtcgccgagcgggatggtcacgacttcatcccgtcggccctggagagcggcgcg
gcggcgtacttcacctcgcgcgcggaggtctctcgcggcaccgccattcgcgtccccgac
accgccctggccctcgctgatctcgggcgtgcggtccgcggccgtattcccgaccgcgtc
gtgggcatcaccggctcggtcggcaagacctccaccaaggacctcctggccggggtcctg
cagaccacctaccgcaccgcggcgagcgagaagtccttcaacaacgaactgggccttccg
ctgaccctggcgggcgcggccgacgacgtcgaagccgtggtcctcgagatgggtgcgcgc
gggatcggccacatcgacctgctgtgctccatcgcgagcccgaccgtcggcgtgatcacg
cgcgtcgaaggtgtccacctcgagttgttcggggacatcgaatcggtggcccgcgcgaag
ggtgagctggtcgagtcccttccggccgacgggatcgcggttctgaacgccgatcaccgg
tacgtcgcggcgatggcggagcgcacctcggcccgggtgctgcggtacggcctgtcgccg
gacgccgacgtatacgcgtcggacatcgtcgtcgacgacgagctgcgagcatcgttccgg
ttgcacacgccgtggggttcgaccgacgtgcgcctcggcgcgcggggtgagcaccaggtc
cgcaacgcgctcgcggccgcggcggccggcggcggtctcggagtgtccgtcgaggacatc
gccaatggtatgtctgccgccgaattgtccggtctgcgaatggaactcgcgaagaacgcc
gacggcacgatcgtgctcaacgacgcctacaacgcgaacccgacgtcgatgtcggcggca
ctgaagtcgctcgccgcgctgcccgcgggacgacgcgtcgccgttctcggaaccatggca
gaactcggatcggactctccggcccagcatcacgcgatcgcactcgaggcacacgaactc
gacatcgaggtcatcgcggtcgacgaacccgactacggcgacaccgcgcgccacacctcc
ggcgtcgacgaagcggttgccgcactcggcgacctcgccggaggagatgcggtactggtc
aaaggaagtcgcgtcgccgcactggagcgggtggcgcaggccctgctgagctga

DBGET integrated database retrieval system