KEGG   Gordonia alkanivorans: C5O27_04480Help
Entry
C5O27_04480       CDS       T05876                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gav  Gordonia alkanivorans
Brite
KEGG Orthology (KO) [BR:gav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gav01001]
    C5O27_04480 (pknB)
Enzymes [BR:gav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C5O27_04480 (pknB)
Protein kinases [BR:gav01001]
 Serine/threonine kinases: Other
  Bacterial family
   C5O27_04480 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH PepSY_2 Pkinase_fungal Seadorna_VP7 Kdo RIO1 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AZZ80434
UniProt: A0A3T0UWD9
LinkDB All DBs
Position
977786..979735
Genome map
AA seq 649 aa AA seqDB search
MTTPHHLSDRYELGETLGFGGMSEVHYARDLVLHRDVAIKVLRADLARDPSFYLRFRREA
QNAAKLNHPTIVQVFDTGEAETEDGPLPFIVMEYVDGDTLRDVLRANGPIAPRQAMTWMA
DVAAAMDFSHRNGIVHRDMKPANVMIDKSGAVKVMDFGIARAMSDSTSTMTQTSAVMGTA
QYLSPEQARGIKVDPRSDIYSMGCVLFELLTGEPPFTGDSPVAVAHQHVHEDPPWPSHVR
PDIPRELDSIVLKAMSKNKDNRYQSAADLRADLIRVLAGGKPSAPMLLTDEERTEFIDTG
PRRPVRSETTGPRRAIPARAGGSHRRDADYRSDSDDDPPRRRSRRLMAGAIAAVVLLVGT
LFLWSPWSSGSDPDVSVPAVAGLSSEDAQSALERAGFEVRVLEEPSLDVGPGLATRSTPG
EGVLAAEGSEVALYISTGPQRHRIPSDLVGKTPAEALDALKVLGFTNVKTERVDSTVDMK
DKVVSTAPKIGTEVPVNGPVVLNVGNGPREITVRDVIGMPADRARAVLEELGMTVDEVAV
DSDQRAGEVLSTSPGPGSTAEQGSTVQISVSRGNLFTVPSLRGKTPAEAQASLEQAGWER
STLTRQTRNVPLNSPDNGRVVGQEPPAGSKARKSGAVTIIIGQASLLPN
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaccacaccacctctccgaccgctacgaactcggcgaaacgctgggtttcggt
ggcatgtccgaggtgcactatgcccgcgacctggtgttgcaccgggacgtggcgatcaag
gtgttgcgcgccgacctcgcgcgcgatccgtcgttctacctgcgcttccggcgtgaggcc
cagaacgcggcgaagctgaaccacccgacgatcgtccaggtcttcgacaccggcgaggcc
gagaccgaggacggtccgctgccgttcatcgtcatggagtacgtcgacggcgacaccctg
cgagacgtgttgcgcgccaacggtccgatcgcgccgcggcaggcgatgacgtggatggcc
gatgtcgccgccgcgatggacttctcgcaccgcaacggcatcgtgcaccgagacatgaag
ccggcgaacgtgatgatcgacaagtccggcgcggtgaaggtgatggacttcggcatcgcg
cgcgcgatgagcgactccacgtcgacgatgacgcagacctccgccgtcatgggcaccgcc
cagtacctgtcgcccgagcaggcccgcggcatcaaggtcgacccgcgcagcgacatctac
tcgatgggctgcgtgctgttcgagctgctcaccggggagccgccgttcaccggtgattcg
ccggtcgcggtcgcccaccagcacgtgcacgaggacccgccgtggccgtcgcatgtgcgt
cccgacatcccgcgcgagctcgactcgatcgtgctcaaggcgatgagcaagaacaaggac
aaccggtaccagtcggccgccgatctgcgcgccgacctgatccgggtgctcgccggcggc
aagccgtcggcaccgatgctgctcaccgacgaggaacgcaccgagttcatcgacaccggc
ccccgacgccccgtccggtcggaaacgaccggaccgcggcgcgccatccccgcccgtgcc
ggtgggagccaccgacgcgacgccgactaccggtccgactccgacgacgatccgccgcgt
cggcggtcccgccggctgatggccggcgcgatcgccgcggtcgtgctgctggtcggaacg
ctcttcctgtggtctccgtggagttcgggctccgatcccgacgtcagcgtgcccgcggtc
gccggactgagttccgaggatgcgcagtcggccctcgaacgagccggtttcgaggtgcgt
gtcctcgaggaacccagcctcgacgtcgggccgggtctcgcaacccgctcgacgcccggc
gagggtgtgctggcggccgagggctccgaggtcgcgctgtacatctcgaccggtccgcaa
cggcaccggataccgtccgacctggtcggcaagactccggccgaagccctggatgccctc
aaggtgctcgggttcaccaacgtcaagaccgaacgtgtggattcgaccgtcgacatgaag
gacaaggtcgtgtcgaccgcgccgaagatcggcaccgaggtgcccgtcaacggaccggtg
gtcctcaacgtgggcaacggccccagggagatcacggtccgcgacgtcatcggcatgccg
gccgaccgcgcccgcgcggtcctcgaagagctcggcatgacggtcgacgaggtggcggtc
gactccgaccagcgcgcaggcgaggtcctctccacctctcccggtcccggttcgacggcc
gagcagggcagcacggtgcagatctcggtgtctcggggcaacctgttcaccgtcccgagc
ctgcgcggtaagacacccgccgaggcccaggcatccctggaacaggccggctgggaacgg
tcgacgctgacgcgtcagacgcggaacgtgccgctgaacagtcccgacaacggacgggtc
gtcggacaggaaccgccggcgggctcgaaggcgcgcaagagcggcgcggtcacgatcatc
atcggccaggccagcctgctgccgaactag

DBGET integrated database retrieval system